SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003782 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003782
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.83e-34
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 323-475
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000149
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 211-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000293
Family VWC domain 0.016
Further Details:      
 
Domain Number 4 Region: 632-704
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000649
Family VWC domain 0.0093
Further Details:      
 
Domain Number 5 Region: 468-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003782
Domain Number - Region: 276-341
Classification Level Classification E-value
Superfamily FnI-like domain 0.00115
Family VWC domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003782   Gene: ENSORLG00000003018   Transcript: ENSORLT00000003783
Sequence length 757
Comment pep:known_by_projection chromosome:MEDAKA1:6:7220535:7305593:1 gene:ENSORLG00000003018 transcript:ENSORLT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFEGSSREVRASAEVSAQMLKKLKGKNEFTVLATVKQDRLNSGVILSVHQSDHRFLELE
SSGQRSEVRLHYRTKNQKDHTEVFPYSLADDQWHKISVAVSASHVILHVDCNRIYERVVE
APSMDIPEDTSFWLGQRNAAHGFFKGVMQDVEVLVMPQGYISQCPDLNRTCPTCNDFHGL
VQKIMELQDILAKTSSKLSRAEEKMNGLDGCYCERTCSVKGVIYREDEGWTDGCKNCTCT
NGTVHCEAISCPPPQCPAGTAPAYIKGACCKECQPVCLFGGRELVEGDQRAVRDSSGRCL
LFECRDRSMHRVVPSEPCPELSCPESEQIALSNRCCKVCRGHDFCSEGHGCLEHSDCVNL
EAGDCCVCKDGFRPLRDDNAYCDDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRID
DYSCTEHDECLSGLHNCDENALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCV
SPNKCVCQQGFTGSRCETDIDECADGFVECDSKSTCVNLPGWYHCECRDGYHDNGLFSAN
GESCVDINECKTGRNTCANDTVCFNLEGGYDCRCPHGHNCTGDCIHDNKVKHSGQIWVLD
NDRCSVCSCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCLHQNGLLTYGSGDTWV
ENCQQCQCLQGQVDCWPLPCPPVDCEFTVVPEGECCPRCVTDPCQADTIRNDITKTCTDE
HNISRFSGSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences H2LCY8
ENSORLP00000003782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]