SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003855 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003855
Domain Number 1 Region: 157-384,427-476
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.45e-49
Family Glycerol-3-phosphate transporter 0.056
Further Details:      
 
Domain Number 2 Region: 596-741
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-18
Family Glycerol-3-phosphate transporter 0.047
Further Details:      
 
Domain Number 3 Region: 500-581
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000732
Family Pentapeptide repeats 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003855   Gene: ENSORLG00000003092   Transcript: ENSORLT00000003856
Sequence length 744
Comment pep:known_by_projection chromosome:MEDAKA1:11:6246856:6265355:1 gene:ENSORLG00000003092 transcript:ENSORLT00000003856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVGDPFIMEDGYQNRTAFIKGAKDIAKEVKRQASKKVGRSVDKMSDEYARRSYSRFEEDD
DDEYPMQGSQDGGYYRGDSTARNDDEGGHSDSTEGHDEDDEIYEGEYQGIPRADSGKGSL
AGGPGSITAGAQEFRDIDVSDAQRKKDKEELAQQYETILQECGHGRFQWSLYFVLGLALM
ADGVEIFVVGFVLPSAEKDMCLSEPNKSMLGLIVYFGMMVGAFLWGALADRIGRRQSLLI
CLSINSVFSFFSSFVQGYSTFLFCRLLSGVGIGGSIPIVFSYYSEFLAQEKRGEHLSWLC
MFWMIGGIYASAMAWTIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAIAALNAMPES
PRFYLENGKHDEGWMILKQVHDTNMRAKGHPEKVFSVTTIKTVKPADELVNIGTDTPVWE
RYRQKIMSLSKQIRKNLLACFSPEYKRTTFMLMAVWFTMSFSYYGLTVWFPDMIKYIQKQ
EYDSRTKTFTKERVEHVTFNFTLENQIHRNGYYFNDKFLNLKMKSMVFEDSVFEECYFED
ITSTNTFFKNCTFIASLFYNTDLFKYRFVDCKLANSTFLHNKEGCVLDFSDDFNNAYMIY
FINFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSIISCVSCFFLMFGNSESGMIALLCLF
GGISIASWNALDVVTVELYPSDKRTTAFGFLNALCKLAAVLGISIFQSFVGITKALPILF
AAGALAAGSFLATKLPETRGQVLQ
Download sequence
Identical sequences H2LD56
8090.ENSORLP00000003855 ENSORLP00000003855 ENSORLP00000003855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]