SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003976 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003976
Domain Number 1 Region: 627-697,926-1273
Classification Level Classification E-value
Superfamily Ras GEF 1.15e-116
Family Ras GEF 0.0000134
Further Details:      
 
Domain Number 2 Region: 221-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-43
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 23-130
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-18
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 4 Region: 431-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000951
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003976   Gene: ENSORLG00000003190   Transcript: ENSORLT00000003977
Sequence length 1276
Comment pep:known_by_projection chromosome:MEDAKA1:9:6058511:6111051:1 gene:ENSORLG00000003190 transcript:ENSORLT00000003977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALFLSAVARKEGTKRGFLSKKTTENSRWHEKFFALYQNILFYFENEQSA
RPAGIYLEGCTCERVPAPKPPLSACEPAGKQEHYFLIVFGHDGQKPLELRTDEESECDEW
VEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKSEIVA
LNKTKERMRPYHVYHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
VMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIDCTLIEEPDANDEESKAGG
QVFGQLDFKLVVEPSDLPSFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENS
KVTVPHMINTQKSTWQSPMRGSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLT
DLRFLSIDFLNTFLHTYRIFTTATVVMDKLADIYKKPFSSIPISWVPRSLELFFATNQNN
RSGEHINDRSPRLCRKFSSPPPLCIPSRTNSPVRTRKLSLHSPITARVIGLDLTSPLSNF
SLDHNSSQSAASSPTSVATPQTPTPQTPTPTTTSPSPPSSTSPPPNNGSLDQWGSAMGRI
REMGGLEREQSSEAGDTSPCRSPSTPRHLRYRQPGEYPIVDFNAACLKKTKFQSGENSRC
SVSPASAFAIATAAAGHGTPPGTHAYTRFLNAFELFTNSERTCDKDFIIRRAATNRVLNV
LRHWVSKHSQDFEMNGELKMSVICLLEEVLRDPDLLPQERKATANILSALSQDEQEDAQL
RIEDILQMADCLKAECFESLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKVDKTDRTP
YIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALN
RSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDL
AFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQVKVTQYLLDKTLTMDE
DTLYDLSLKIEPRLPA
Download sequence
Identical sequences H2LDH1
ENSORLP00000003976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]