SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003979 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003979
Domain Number 1 Region: 267-475
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.38e-37
Family Reprolysin-like 0.0026
Further Details:      
 
Domain Number 2 Region: 562-619
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000314
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 1213-1272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000719
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 1164-1214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 1358-1417
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 6 Region: 1590-1639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 1026-1086
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1308-1361
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 1082-1143
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000129
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 1476-1532
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 969-1030
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000641
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 12 Region: 1422-1476
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000667
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 13 Region: 1531-1590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000105
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 14 Region: 1658-1698
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000811
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003979
Domain Number - Region: 857-910
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00034
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number - Region: 908-970
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0209
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003979   Gene: ENSORLG00000003194   Transcript: ENSORLT00000003980
Sequence length 1915
Comment pep:known_by_projection chromosome:MEDAKA1:6:7434286:7521924:1 gene:ENSORLG00000003194 transcript:ENSORLT00000003980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFAIWLLGLTCHLSLLVRVALQQRLHPKQERFIKQLSSYEITTPLRVNDFGESFPHSLH
FRRRRRSVDDDLSGTRVHYRIDAFGELFHLNLTADSSFIASSYTVTHLGAERDNGTEPRS
RDMRHCFFRGHVNAKREHPAVFSLCSGLIGTFTTQHGEYFMEPLLPADGDQYEETHNKPH
LVYRQERRNVSSADEPHAAPGSNTKNMPNIDTKKTGSFCWSQFVKSRGDMRKELDSFRNT
IEQQESHETNSTGEHSRPGRRRKRFLSYPRYVELMVTADAKMAQHHGRNLEHYILTIMSV
VSKLLKKRSNIFRLYDMMFNVKQEGPTVSFDAATTLHNFCVWQQNQNVQEDSDPSHHDTA
LLITREDICRAKHKCDTLGLAKLETLCDKLQGGCIRMEQSSRCMFFSSVPEITQVWFNMP
HDDSPMCREAGMKHQYHVMAPTLNYDTNPWSWSKCSRKYITEFLDTGYGECLLDEPVGRI
YELPTLLPGQIYNANRQCELMFGPGSQICPYMKQCKRLWCTSSEGDHKGCRTQHMPLADG
TDCGHGMYCRHGMCVNKELDLQPVHGEWGPWGPYSACSRSCGGGTRSATRDCKKPEPRNG
GRFCVGRRMKFRSCNTEPCPRGKKDFREEQCSQFDGKHFNINGLTPNVRWVPKYSGILMK
DRCKLFCRVAGAMMYYQLKDRVIDGTPCGPDTYDICVQGLCRQAGCDHVLNSKARNDKCG
VCGGDNSSCKTLAGTFNDAQYGYNTVVRIPAGATNIDIKQVSYSGKPEDDSYLALSDSQS
NFLLNGNFVVSMFKREITLKGTVIEYSGSDTKVERINCTDRIEEEIILQVLCVGNPHNPD
VRYSFNIPIEEHREQFLWDPSGSWLECSRMCHGERRRKAVCFRQSDHLEVSDQRCEHLPR
PVAVTEPCNADCEVRWHVAGKSECSAKCGPGHRSLDIQCMKYSLLQRESERVEASACAEI
PKPHTRESCHGDCLLKSWQYSAWTQCSKTCGRGSRSRESYCMNNLGRRLVDRECSEFQRV
VIETCNDLPCPQWTVNEWSECLVTCGKGMKHRLVTCMGGEEEKLSEQYCDLSTKPAATES
CQLPECASWQVGIWGACAVTCGHGYQMRAVRCVLGDYGNTVDDRECNAAARPRDSQECEM
PACPWISPVQSTPRPDNSAQLHTQWRYGSWTACSVSCGKGKQARYVTCINAQGAVADESY
CAHLPRPPEFSTCFSPCGQWHAREWSTCSVTCGVGRATRQVVCSNYHHPVDQSFCDNDDK
PATEQECTAGPCPSVYNRQRIYEQPYGYPQDPGHHPGHSSWNVPSADNQWRTGPWGACSS
TCEGGFQRRVVVCQDGDGRSNSYCDERIKPAESKSCDSGPCPLWNYGVWGECTQPCGGGR
RTRLVVCQRPNGETLIDYNCDMLDKPLDMEQCNLQPCPGSASWHRQPWKPCSVSCGRGIK
QREIACVYQNQTKLEEAHCSHLQRPRTQKACRARICPTWKTSRWRECSVTCGFGVQNRDV
YCRLKGAGRVREDLCDAGTRPLFLQPCHTAECTHYTWVTGEWDKCNVSCGDGTRSRKVWC
AGPEMTPAQNDYCEPSSRPPSVQSCTEAACQYVWVTGEWSQCSVTCGIGYQQRYVSCSMI
PSSPGQGLYAQTPIAAEKCLEPSPPGTRPCVLRECSNTAYWKAGPWSKCSQTCGAGLMER
RVECMTLKGQPSKVCHHSERPASQAACQDRQCKLFTSCREVQMRQGVRMNGEYYLKVKSR
ILQIYCAEMQTDFPKEYVTLRSGQTDNYSEVYGSHRLLNPFECPNNGSRLQDCSCRNDYS
AAGYTLFHKVRLDLSSLRIMITDLQFSQTLLGRPVPFATAGDCYSAAKCPQGQFSINLTG
TGLKVAPATKWTSQGNYVSVKVHRSEDGTRIYGRCGGFCGKCIPQAHSGLLLQVH
Download sequence
Identical sequences H2LDH4
8090.ENSORLP00000003979 ENSORLP00000003979 ENSORLP00000003979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]