SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003982 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003982
Domain Number 1 Region: 323-382
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 468-527
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000667
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 3 Region: 172-232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 418-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 115-176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 281-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000105
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 7 Region: 231-278
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003982
Domain Number - Region: 3-56
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00012
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number - Region: 54-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00562
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003982   Gene: ENSORLG00000003194   Transcript: ENSORLT00000003983
Sequence length 538
Comment pep:known_by_projection chromosome:MEDAKA1:6:7486865:7501562:1 gene:ENSORLG00000003194 transcript:ENSORLT00000003983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFLWDPSGSWLECSRMCHGERRRKAVCFRQSDHLEVSDQRCEHLPRPVAVTEPCNADCEV
RWHVAGKSECSAKCGPGHRSLDIQCMKYSLLQRESERVEASACAEIPKPHTRESCHGDCL
LKSWQYSAWTQCSKTCGRGSRSRESYCMNNLGRRLVDRECSEFQRVVIETCNDLPCPQWT
VNEWSECLVTCGKGMKHRLVTCMGGEEEKLSEQYCDLSTKPAATESCQLPECASWQVGIW
GACAVTCGHGYQMRAVRCVLGDYGNTVDDRECNAAARPRDSQCSVSCGKGKQARYVTCIN
AQGAVADESYCAHLPRPPEFSTCFSPCGQWHAREWSTCSVTCGVGRATRQVVCSNYHHPV
DQSFCDNDDKPATEQECTAGPCPSVYNRQRIYEQPYGYPQDPGHHPGHSSWNVPSADNQW
RTGPWGACSSTCEGGFQRRVVVCQDGDGRSNSYCDERIKPAESKSCDSGPCPLWNYGVWG
ECTQPCGGGRRTRLVVCQRPNGETLIDYNCDMLDKPLDMEQCNLQPCPGSASWHRQPW
Download sequence
Identical sequences H2LDH7
ENSORLP00000003982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]