SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004265 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004265
Domain Number 1 Region: 239-423
Classification Level Classification E-value
Superfamily Bet v1-like 6.48e-17
Family STAR domain 0.00000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004265   Gene: ENSORLG00000003431   Transcript: ENSORLT00000004266
Sequence length 430
Comment pep:known_by_projection chromosome:MEDAKA1:8:5742580:5748881:-1 gene:ENSORLG00000003431 transcript:ENSORLT00000004266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTGMQGGEYGELGGSLPAIASLNASYSTSLSIPSPYMLLPPAKLKTISDVRRTFCLFVTF
DLLFISLLWIIELNLHTSESIWDCLKEEVGEYSFKSSFFDITLLAFFRFLCLQVGYAAFR
LRHWWVVAGTTLVTTVFLVAKVIISNPLLSQIAYGYVLPITSFVVAWLETWFLDFKVLTQ
EAEDERAYVAAVNAACERAPMIYPRAVSDGQFYSPPESIAGSEEELDEEGLGRKAVTAQE
KEYVRQGKEAMSVVEQILTQEENWKFEKNNEMGDSVYTLEIPYHGKTFILKALMQCPAEL
VYQEVILQPEKMVQWNRTVSVCQVNAQTAHIKKKIETKGRVPNRIFFFFVSAPVSKRFEK
RNAHICSIIRKGCKNMLNTPKTTFSSEWVFHKTFGGRLPRYLINQSLAATMFEFMSHLRQ
RMAEIRPSLR
Download sequence
Identical sequences H2LE96
ENSORLP00000004265 8090.ENSORLP00000004265 ENSORLP00000004265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]