SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004345 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004345
Domain Number 1 Region: 87-146
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000297
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 256-313
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000184
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004345   Gene: ENSORLG00000003491   Transcript: ENSORLT00000004346
Sequence length 393
Comment pep:known_by_projection chromosome:MEDAKA1:8:5860135:5877778:1 gene:ENSORLG00000003491 transcript:ENSORLT00000004346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLQRLKRSLSFKTMMRSKSVENFFQRSYSDARLPPDFITDPPPPSPPLMPGSPLVGERSP
SISPSLSPNPSISSHSPSLSLSPSLPAKPYRPQINHCFQDHVFRKPTNCQHCKQMIVGNS
KQALRCKTCKMAAHLWCTSELSQQPCHGKSGAFKRNFSSPMLVNDQLSVVKEVLPSQETA
RMRVDPVYAALRYGTSLAQMSRSSFGSLSESPTRSLGEGGEERQQRQCSMEEEITLETGD
TLVADEEMEKEVDESSEQAQVLSEIPKRIEVHSIHTYVALYKFLPQEQNDLELHPGDRVQ
VIDDSNEEWWKKRRKQRVNEKTEGFWLQRTGRKRKGERVWRVVQGTSGNRERGHMAVRES
QICVGKRDDGEVFVKLSSGKKRGLVPADSIEEI
Download sequence
Identical sequences H2LEH5
8090.ENSORLP00000004345 ENSORLP00000004345 ENSORLP00000004345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]