SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004375 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004375
Domain Number 1 Region: 47-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 111-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000209
Family Fibronectin type I module 0.082
Further Details:      
 
Domain Number 3 Region: 213-258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004375   Gene: ENSORLG00000003512   Transcript: ENSORLT00000004376
Sequence length 366
Comment pep:known_by_projection chromosome:MEDAKA1:11:8401841:8409745:1 gene:ENSORLG00000003512 transcript:ENSORLT00000004376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLWILTAAGIQQAYALNSTAMPLSTAFTPPPTDAYNRTQYCKWPCECPEVPPKCPP
GVSLLTDGCECCKACARQVGEVCNEADTCDYHKGLYCDYSSDKPRYEKGVCAYMVGTGCE
HNGVIYRNGQSFQPSCKYQCVCVNGAIGCVALCSESQPPRVWCQNPRRIKVRGQCCEKWI
CDEPRRGRKAAPRHAVEGKHTFLYLSKNRSWDNNCISQTTSWSPCSKTCGRGLSLRISNA
NDQCQMVKESRLCNLRPCEVDITNHIKPGKKCLNIYREDQPLNLTLSGCTSKKQYRPKYC
GVCTDERCCIPYKSKTIDVEFECPNGAGFTWKMMWIQACFCNLSCRNPNDIFAELENYYG
YPEVID
Download sequence
Identical sequences H2LEK1
8090.ENSORLP00000004375 ENSORLP00000004375 ENSORLP00000004375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]