SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004531 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004531
Domain Number 1 Region: 460-704
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-57
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 384-471
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-33
Family Kringle modules 0.0000911
Further Details:      
 
Domain Number 3 Region: 186-271
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-31
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 99-182
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-30
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 5 Region: 7-99
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-30
Family Kringle modules 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004531   Gene: ENSORLG00000003636   Transcript: ENSORLT00000004532
Sequence length 706
Comment pep:known_by_projection chromosome:MEDAKA1:5:6238404:6260423:-1 gene:ENSORLG00000003636 transcript:ENSORLT00000004532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKRNVNCDLYEKKVYVRQCIVGKGEDYRGKVFTTKSGLNCQQWWSKFPHDHWWTPTASNG
LELNYCRNPDGDNIGPWCYTTDPERRYESCNIPQCKDEVCITCNGEDYRGQVDHTATGKE
CQRWDQQHPHQHIYQPEKYPDKSLDDNYCRNPDASPVPWCYTTDPLVERENCNISKCRNY
PTMFLCNKDCFRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPFHPNIYECKGLEENYCR
NPDGSEAPWCFTSAPEMRTALCLQIKRCEDDIEAEGMLVRPPKPLTDNNRCVIHHEKNAK
NKMLKTVFSWSGSLEDCSSLFIQTGPDKTLRRHFDKNDGTKSPAPLTVSTNHSWNPASDR
GTSEQNNEAQRRDLFASFEFILKIENGKNYRGIVRKTRKGVTCQRWNVNTPHRTKINPLT
HPEANLTENYCRNPDGDQHGPWCYTTDPKTEFDYCAIKQCEKVEFSECGQRDDRPQRFLR
IVNGIPGNSPWTVSLRDRKGNHFCGGSLVYSRWVISTKQCFSSWLYRESIYKVWGYLNQE
EEGEPSVQVIPLTKIVCGPSESQLVMLQLEFPAQFNERVSQICLPPERYIVPEGTECEIA
GWGETKGTGDETVLNVAKVPVISNRICNQYFRGRVRENEMCTNSFQGGVGACEKDYGGPL
ACRNSDCWVLEGVIIPMRRCGHPGQPNIFIRVSVYVDWIKKVMEMA
Download sequence
Identical sequences H2LF02
ENSORLP00000004531 8090.ENSORLP00000004531 ENSORLP00000004531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]