SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004565 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004565
Domain Number 1 Region: 92-139
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-19
Family RING finger domain, C3HC4 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004565   Gene: ENSORLG00000003666   Transcript: ENSORLT00000004566
Sequence length 155
Comment pep:known_by_projection chromosome:MEDAKA1:9:6820112:6846867:1 gene:ENSORLG00000003666 transcript:ENSORLT00000004566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPFQWCNGCFCGLGLVYSNKSCTMPPITFQDLPLNIYMVIFGTGIFVFILSLIFCCYFI
SKLRHQAQSERFGYREVILKGDPKKLSLHGQTCAVCLEDFKVKDELGVLPCQHAFHRKCL
VKWLEVRCVCPMCNKPIAGPPEQHHSIGTLLDELV
Download sequence
Identical sequences H2LF34
ENSORLP00000004565 XP_004072251.1.28442 8090.ENSORLP00000004565 ENSORLP00000004565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]