SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004805 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004805
Domain Number 1 Region: 215-271
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-20
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 56-110
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000715
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 
Domain Number 3 Region: 276-331
Classification Level Classification E-value
Superfamily SH3-domain 0.0000441
Family SH3-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004805   Gene: ENSORLG00000003847   Transcript: ENSORLT00000004806
Sequence length 333
Comment pep:known_by_projection chromosome:MEDAKA1:7:7567117:7571281:-1 gene:ENSORLG00000003847 transcript:ENSORLT00000004806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQEDDKNSVDIHDNPPVPDNVVREEGDTVYFIYEEEVEVEEKEPEPPPEPILRINDKPH
KFKDHYCKKPKFCDVCARMIVLNNKFCLRCKNCKTNIHHSCQSYVEFQKCFGKIPPGFRR
AYSSPLYGSDQPDPNNPNRNDPVFDTLRVGVIMANKERKKNENDKKNLMMMEEEEEEENQ
QPKEHEEGGEGKPEDKKEKGGDKADDKSKGTFTGSHYYLALYRFKAIEKDDLDFHPGDRI
IVLDDSNEEWWRGKMGEKTGYFPTNYIIKVRASERVFKVTRSFVGNREMGQITLKKDQIV
VKKGDEKGGYLKVSTGRKLGYFPADLLEEITVT
Download sequence
Identical sequences H2LFR6
8090.ENSORLP00000004805 ENSORLP00000004805 XP_011475167.1.28442 ENSORLP00000004805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]