SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004810 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004810
Domain Number 1 Region: 111-470
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.4e-91
Family Phosphonoacetate hydrolase 0.0091
Further Details:      
 
Domain Number 2 Region: 544-806
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-21
Family DNA/RNA non-specific endonuclease 0.017
Further Details:      
 
Domain Number 3 Region: 62-101
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000157
Family Somatomedin B domain 0.0035
Further Details:      
 
Domain Number 4 Region: 14-55
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000876
Family Somatomedin B domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004810   Gene: ENSORLG00000003852   Transcript: ENSORLT00000004811
Sequence length 808
Comment pep:known_by_projection chromosome:MEDAKA1:16:5033841:5067960:-1 gene:ENSORLG00000003852 transcript:ENSORLT00000004811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSARSSPPYAPMSGSCRSRCFELVEVEPPSCRCDNLCKTYHGCCSDFDQLCLRTDGGYEC
SKDRCGETRNDQHACHCSDDCLSRGDCCTNYRKLCKGEPSWLQGDCEEMKSADCPAGFVR
PPLIILSVDGFRASYVKRGSTVIPNIEKLRTCGTHAPYMRPVYPSKTFPNLYSIATGLYP
ESHGIIGNSMYDPQFDAFFNLRSQEKLNHRWWGGQPIWITAVKQGVKAATFFWPVSVPIE
RRILTMLQWLHLPDGERPYVYAMHFEQPDIYGHKMGPMSADLNNPLRMIDRIVGQLMDGL
KQMKLHRCVNVILAGDHGMEEAHCDHTEFLSNYMSVDDIALIPGTLGRIRARFHSNQKYD
PKTVVANLTCKKAEQHFKPYLKQHLPKRLHYANNRRIEDVHLLVDRRWHVARKVPEGRRH
CGFSGDHGYDNKINSMQTIFLGYGPAFKFKMKVPVFENIELYNVMCDLLGLKPSPNNGTH
GSLNHMLKSPPFKPVMPEEVSRPLPTSTVPMVTDDLGCSCDEKNQVEELNQRLRQAIDDS
RNLPFGRPAVIFRTKYFVLHHVDYISGYSEALAMPLWTSFTVSRQVEMSPVPEALSTCVR
PDARMPPASSQSCTNYRAVRHVTSAFLYPPQLSSTWDRKSEAVLITNTVPMFPAFKRIWV
YFQKVLVKKYATERNGVNLLVGPIFDYNYDGVRDSTETMKEYVSGPFAIPTHFFVVLTSC
LDYTQTADACTGPLSSAAFILPHRPNNDETCNSSEDESRWVEDLMKMHTARVKDVELLTG
LDLYRRTPRSYAEILSLKTYMHTYESEI
Download sequence
Identical sequences H2LFS1
ENSORLP00000004810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]