SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004813 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004813
Domain Number 1 Region: 107-472
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.56e-90
Family Phosphonoacetate hydrolase 0.0091
Further Details:      
 
Domain Number 2 Region: 577-840
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 6.47e-21
Family DNA/RNA non-specific endonuclease 0.017
Further Details:      
 
Domain Number 3 Region: 58-97
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000157
Family Somatomedin B domain 0.0035
Further Details:      
 
Domain Number 4 Region: 10-51
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000929
Family Somatomedin B domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004813   Gene: ENSORLG00000003852   Transcript: ENSORLT00000004814
Sequence length 842
Comment pep:known_by_projection chromosome:MEDAKA1:16:5033841:5067948:-1 gene:ENSORLG00000003852 transcript:ENSORLT00000004814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPPYAPMSGSCRSRCFELVEVEPPSCRCDNLCKTYHGCCSDFDQLCLRTDGGYECSKDR
CGETRNDQHACHCSDDCLSRGDCCTNYRKLCKGEPSWLQGDCEEMKSADCPAGFVRPPLI
ILSVDGFRASYVKRGSTVIPNIEKLRTCGTHAPYMRPVYPSKTFPNLYSIATGLYPESHG
IIGNSMYDPQFDAFFNLRSQEKLNHRWWGGQPIWITAVKQGVKAATFFWPVSVPIERRIL
TMLQWLHLPDGERPYVYAMHFEQPDIYGHKMGPMSADLNNPLRMIDRIVGQLMDGLKQMK
LHRCVNVILAGDHGMEEAHCDHTEFLSNYMSVDDIALIPGTLGRIRARFHSNQKYDPKTV
VANLTCKKAEQHFKPYLKQHLPKRLHYANNRRIEDVHLLVDRRWHVARGLCFLGKVPEGR
RHCGFSGDHGYDNKINSMQTIFLGYGPAFKFKMKVPVFENIELYNVMCDLLGLKPSPNNG
THGSLNHMLKSPPFKPVMPEEVSRPLPTSTVPMVTDDLGCSCDEKVYPKNQVEELNQRLR
GDTSLSTFVMVGRTRQCKAQGLKNAQRNVSFTNSRNLPFGRPAVIFRTKYFVLHHVDYIS
GYSEALAMPLWTSFTVSRQVEMSPVPEALSTCVRPDARMPPASSQSCTNYRAVRHVTSAF
LYPPQLSSTWDRKSEAVLITNTVPMFPAFKRIWVYFQKVLVKKYATERNGVNLLVGPIFD
YNYDGVRDSTETMKEYVSGPFAIPTHFFVVLTSCLDYTQTADACTGPLSSAAFILPHRPN
NDETCNSSEDESRWVEDLMKMHTARVKDVELLTGLDLYRRTPRSYAEILSLKTYMHTYES
EI
Download sequence
Identical sequences H2LFS3
8090.ENSORLP00000004813 ENSORLP00000004813 ENSORLP00000004813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]