SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004821 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004821
Domain Number 1 Region: 1458-1636
Classification Level Classification E-value
Superfamily Fibronectin type III 6.4e-29
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 2 Region: 1642-1811
Classification Level Classification E-value
Superfamily Fibronectin type III 3.86e-27
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 3 Region: 911-1069
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 1914-2086
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-22
Family Fibronectin type III 0.00023
Further Details:      
 
Domain Number 5 Region: 1272-1458
Classification Level Classification E-value
Superfamily Fibronectin type III 6.87e-22
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 6 Region: 727-893
Classification Level Classification E-value
Superfamily Fibronectin type III 6.69e-21
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 7 Region: 354-409
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-20
Family Fibronectin type II module 0.00019
Further Details:      
 
Domain Number 8 Region: 1819-1909
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-19
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 9 Region: 414-468
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-19
Family Fibronectin type II module 0.00016
Further Details:      
 
Domain Number 10 Region: 2323-2366
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000393
Family Fibronectin type I module 0.0015
Further Details:      
 
Domain Number 11 Region: 563-609
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000144
Family Fibronectin type I module 0.0036
Further Details:      
 
Domain Number 12 Region: 90-134
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000249
Family Fibronectin type I module 0.00023
Further Details:      
 
Domain Number 13 Region: 2278-2321
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000667
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 628-698
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000175
Family Fibronectin type III 0.0000917
Further Details:      
 
Domain Number 15 Region: 521-565
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000209
Family Fibronectin type I module 0.0084
Further Details:      
 
Domain Number 16 Region: 1095-1260
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000318
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 17 Region: 476-515
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000508
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 18 Region: 180-225
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000785
Family Fibronectin type I module 0.00044
Further Details:      
 
Domain Number 19 Region: 137-177
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000916
Family Fibronectin type I module 0.00028
Further Details:      
 
Domain Number 20 Region: 2365-2407
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000209
Family Fibronectin type I module 0.0021
Further Details:      
 
Domain Number 21 Region: 226-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000275
Family Fibronectin type I module 0.0008
Further Details:      
 
Domain Number 22 Region: 310-348
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000406
Family Fibronectin type I module 0.0015
Further Details:      
 
Domain Number 23 Region: 2190-2256
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000901
Family Fibronectin type III 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004821
Domain Number - Region: 48-83
Classification Level Classification E-value
Superfamily FnI-like domain 0.000746
Family Fibronectin type I module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004821   Gene: ENSORLG00000003862   Transcript: ENSORLT00000004822
Sequence length 2453
Comment pep:known_by_projection chromosome:MEDAKA1:3:12888443:12908600:-1 gene:ENSORLG00000003862 transcript:ENSORLT00000004822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGGSLTGLLVALCISSAAHGAPNKSKRQSQYQVDLDLRDPEAVSPVVCQDSGRSYRPYQ
RWEKSYLGSTLVCSCSEAGRVDCTTKPEVEETCHDKYNGETYRIGETYERPRDGMIWDCT
CIGSGRGKISCTIANRCHEGGRSYKIGDTWQRPHDTADYMLECVCLGNGKGEWTCKPVAQ
HCYDNSASSSYAVGETWEKQYQGWMMLDCTCLGEGHGKIQCTSRNRCNDNTVKKSFRIGE
TWMKTDLSGHRVECLCLGNGRGEWKCDRESGAHRFTSTVLTHSNLVWWDTGEGTVVYAPE
RSRFQSNREGTCRTDSGNSYHEGQRWIRTQGSKQMLCTCLGSGASCQELEARNQVYGGNS
NGQPCAFPFVFMGKTYYSCTSEGRTDGQLWCSTTSNYERDQQYSFCTEKNAIVATLGGNS
NGALCHFPFLYSGLNYTDCTSDGRRDGMRWCGTTHYYDSDQLFGFCPMAAHEEVCTTNDG
VMHRVGDKWDKRHEVLGHLMECTCLGNGRGEWNCVAYSQLRDQCIVDGATYEVNQEFSKR
HAEGHMMNCTCFGQGRGWWKCDAIDQCQEPQNRVFYQIGEQWDKVIHGVQYRCHCYGNGI
GEMSCEPQQTYPGGRRPVQVFITEAGKQPDSTPIQWNPPSSAHITHYILKWRIKNRGTPW
REVNIPSHINSYTISGLRPNVIYEGQLISILRFGGREITRFDFTTNHGSLETSEGETAAP
PPLVDTSESVTEITSNSFVVSWSSASATISGFRVEYELSEEGAKTKVLDLPRTTTSVTID
QLLPGRRYNVSVYELPEQGEPNLILTTSQITAPDTPTLPAVDEVGEASIRVSWTRPQAPI
TGYRVVYTPSEEGSSTELTLPNSENSVTLVDLHPGLLYNITIYAVEDQLESEPVFVQVTT
AGSPRQEEVPAPSNLQFYEVSDVKIIITWTGPPRDVTGYRVTYTPMDRDGNELRPLQLPI
SPNAYAELSHLQPGTLYRFYIYAISSGTESKPLVGEKSTRPDAPTNVRFTDVGPDSALVI
WEAPRAVVTGFRLFLSIEGSNSIEKRIPGRTTQYPLKNLRPDTQYTATLHSELDNELSEG
VTNYFTTAPQLGNAPPFSTDVTDTSIIITWIPLRRFSYKLSILPSQDGESPKEETSDSGR
ISIVDLIPGNTYSYSVQPIFNGRNRGNPITRNVVTSLSPPTDLRVVPNPNTGDLTAYWTA
SKTPGITAYRVTSTPTNDQRGNSLDELVPVGQTYCQLENLNLGVEYNISVFSTKGEVESV
PVSTIVTPEIPKPSHIDFVNITDTTIGLRWTPLNSNTITAYRITVVTTGESLPIFQDLVE
VSAGYYTIHGLEPGVDYDISITTVTETGESKAATYTKQTHAAMAPPLYLQFGSVGPDYIR
ITWTIPNIASPSDISRFVIRYHPTATDDDIKEVNVGGATSTYLLNNLQPNTEYHISVVCV
YGERESAPITGIQRTTLDSPTGLDFSDIRTNSFTVHWLPPIASITGYRIHHQKTSGGRAK
DVRVPPTRTHFTLTGLEPDTEYMIYVYAVSHSQESQPLTGTQATTSDALTDLEVTSSTHN
SITIRWEAPSASVNSYRITYGGTIGGESPVERMIPGTQTTYTLTDLEPGTDYTISVYAIS
TRGDTPASNTHATITHRTDTLPPSSMKVMDVSDNAIKVSWSPAQGPIQGYRVTSIPKNGL
GPSYSELVSPDQTEMTITGLMPTVEYVVSVYALGNNGQPSTPMVENAITAMDGPKELTFS
NIDSTSMRITWDSPDGSVTSYRVLYSSSEEGERELRPAPRGSQNSAVLRGLRPGTEYTVK
VIALNGQTPSTPLVGTQATVINAPTNMVISDVGLSSFTVSWQAPNARLTGYRVVITPKNI
NSPSKEMSLSPDTTSVVVPRLTAATEYQIQVYALKNSVTSRPLEGLVTTLEDLSPPWRVQ
QYDVRDTSFKLQWRNKARTLTGILIEITPTSGSLPSITKTIPGDATSYTVTGLQPGTTYS
VNLYSLNGNTRSAPVFLRIETAGPVVQPPTNLRFASVTPTSISFTWQPPASHVSGYYVTY
EELGRSPQQLIPQPHSGQTYATITGLKPNTKYIIRIIAIQNTQRSKPLEGEIRTKPEISL
LPQPHHPSGVSPLDVPETDFGGQGQHVEYIEYNNREDSSGNPQSPYGQVREPLVYVSHPD
AEGRRVPFLKLNVPIGSIPFNESRVPLEAQTQTRISWKPYRQSSAYLVSCYPLTSINEKM
FEIRLPETATTANLIGLTPGANYNVIVEALLGALKHKILEQVVTPGNTIQNGVPSTSDSC
YDTFTSTYYNVGAEWERMSETGFKLWCKCLGMGSGHFRCDSSKWCHDNGVNYQIGEQWDR
QAENGHLMSCTCLGNGKGEFKCEPHKSVCYDDGKTYQVGNQWQKEYLGAICTCTCFGGQQ
GWRCENCRRPGGEVDAIPLQPVRHGDNTLLKKIHCPIECLRPDLLADAQAPPN
Download sequence
Identical sequences H2LFT1
8090.ENSORLP00000004821 ENSORLP00000004821 ENSORLP00000004821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]