SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005119 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005119
Domain Number 1 Region: 508-633
Classification Level Classification E-value
Superfamily TIMP-like 1.18e-22
Family Tissue inhibitor of metalloproteinases, TIMP 0.037
Further Details:      
 
Domain Number 2 Region: 341-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000172
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 272-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000272
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 4 Region: 404-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 89-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000202
Family APC10-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005119   Gene: ENSORLG00000004087   Transcript: ENSORLT00000005120
Sequence length 634
Comment pep:known_by_projection chromosome:MEDAKA1:6:8617547:8624186:1 gene:ENSORLG00000004087 transcript:ENSORLT00000005120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLWALLVIFPVCASSSLSLGISEEKDPITKRACFDRACNPRMGNLAHGRLLRTRSECGS
NTSEPFCFFTQTSAPRHGESCSPAKCSLCGSSIPGHAHPPSAMSDSSFLFPDTWWQSDGE
IEEETLQLDLETKFLFTHLILVFRSPRPAAMVLERSQDHGRTWKALRYYAWSCEEVFGVA
EGASVTESGATCTSKYSGAFPCTRGEVIYRGLSPWSSVDPYGPVAQDQLMITNLRVKLLQ
RQQCPCLTKSSEVPVHPPDHYAIYDFIVKGSCLCNGHADQCIPARSYQPNQQGVANMVHG
KCVCRHNTAGDHCERCAPLFNDRPWQAANGIMGAPHGCQKCKCNGHASNCHFSRGLWMAT
GRRSGGVCDQCRHNTEGRRCQTCKRGYYRDASRPKNAADSCKPCTCHPIGSIFQADGHLC
DPSNGNCTCKPGVGGPQCDRCLMGHWGLHEHGCRPCDCLGDCDPYTGDCSSGSDVEILYA
AADPERQSSNKSETALYRGEELFSALHHSVKCDCEEVPFGSPKHFCSAEFDYVVVVKVMS
AHDKGSHVEVEVKIRKVLHQRPQMKIQRESVTLYPESWTIRGCTCPILNPGFEYIVAGHE
DWNTGHLLINTKSLVKPWKPTLARKILNIRRKCY
Download sequence
Identical sequences H2LGM1
ENSORLP00000005119 ENSORLP00000005119 8090.ENSORLP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]