SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005125 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005125
Domain Number 1 Region: 10-221
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-53
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 210-329
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-25
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 381-556
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-19
Family Pleckstrin-homology domain (PH domain) 0.0000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005125   Gene: ENSORLG00000004093   Transcript: ENSORLT00000005126
Sequence length 558
Comment pep:known_by_projection chromosome:MEDAKA1:6:8645892:8653237:1 gene:ENSORLG00000004093 transcript:ENSORLT00000005126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSRLLQAQSERTKNKIQYIAKEIMTSESVFVDVLKLLHVDFRESVNKASSYHGKPIIEER
LLNQILYYLPQLYELNQDLLKELKQRVDNWNDTSQIADIFLKKGPYLKMYSTYIREFDKN
VALLEEQSRKNLAFGAVVKEFEKSPRCANLALKHYLLKPVQRIPQYQLLLTDYLKNLSEG
TDGYEETKAALSLVKEVANHANDIMKHGDNFQKLIDVQHRLNGNHQIIQPGRIFFKEGIL
MKLSRKVMQPRMFFLFNDILLYTKPVQTGQYKLKNMLSLAGMKVSKPNQEAYQNELNIES
VERSFILSASSATERDDWLNSISAAINDFTKKKITFLSGNPANEADLTDGTPLGSKAPIW
IPDPRTTMCMICTSEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMKKSDRVCDLCFQTL
RQQKCELDNTMSLSPGLKSTMAFSKRQKKIKPAALKEVSASTENSSMSGYLYRSKHKKKQ
GKRLWFVIKDKVLYTYAASEDVAAMESQPLLGFVLKLDSAEQLQFRLFHKNTLYYNFKAD
DVQTAQRWIASFKEATIL
Download sequence
Identical sequences H2LGM7
ENSORLP00000005125 ENSORLP00000005125 8090.ENSORLP00000005125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]