SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005176 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005176
Domain Number 1 Region: 927-1080
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-32
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 2 Region: 190-329
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-31
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 3 Region: 792-919
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 4 Region: 636-778
Classification Level Classification E-value
Superfamily C-type lectin-like 1.96e-28
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 5 Region: 339-476
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-28
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 6 Region: 1232-1364
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-27
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1098-1222
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-27
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 8 Region: 486-621
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 9 Region: 134-192
Classification Level Classification E-value
Superfamily Kringle-like 1.8e-22
Family Fibronectin type II module 0.00083
Further Details:      
 
Domain Number 10 Region: 10-134
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.69e-18
Family Cysteine rich domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005176   Gene: ENSORLG00000004132   Transcript: ENSORLT00000005177
Sequence length 1460
Comment pep:known_by_projection chromosome:MEDAKA1:3:12991752:13015801:1 gene:ENSORLG00000004132 transcript:ENSORLT00000005177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDSCLVWEKKGLFILESILLKRCIKADHSSLVLEDCQRPTLRMLWQWVSSHRLYNLGTGM
CLGLDILNTTHPLGMFECDKAYTMMWWRCRGNTLYGAFQWKVTGAGRLVVVKKSDYYEWK
RHRTPREGPCSYPYEDIHTLLGNANGMPCVFPFNYNNKWYSECTTEGREDNLHWCSTTPR
YDRDERWGFCPVKDSSCERFWESNQELQACYQFNLYTILTWSQALATCQAQGGNLLSITS
MAEQKYIRDRLSSVGTMVWIGLNHLKEGQGWQWSDGAPLSLVNFIPALPASPLQVNRECG
VYNSAYDENWQSLSCESALPYICKKMPNDTRRAEPLENWQYIHTKCDDGWWPHNGFCYRV
LPDSEAGSWQMSSEACSSQGANLTSIHSLSELEMLLFLLANVSGENLEVWIGLWKPLSSP
AVEWSDGSPVTLTLWQQFQPVHNLTETPLCAKLEKKKGNWLLVSCDERLSAVCRRESRSP
VQHSETWDEGCPVGWKRHGHSCYTVTSHEQNYEDALMGFYCKAPLLTVENRFEQTFVNSL
LSASGANCSRDYWIGLTDRENKGEYSWLPLNGSSPPLTFTNWNKHQPVSGGGCVAMSGGP
ALGHWEVKDCKSYKALSVCEQSVSSYHGVELPEHHIDAYAPCPPGWESQSGLLHCFKVFH
DEKVLMKRSWVEADFFCQALGAQLASFHHHEEQDFVNKHLSTMFEGTEGRWFWLGFNKRN
PEHPGVWEWSDGSPVATSFIEDKNEEDDRKDCAVYSDLTSTLTPQPCDAKHEWICKVSRG
DRLRKPYWYTEQSEPWVFFRGAEYLLVKQPFDWHSVSLACQMMGAYLLSIHSREELQFIK
ERLRRFSLGPTDWWIGLSIGPPGEEARWSDNTEVEFQNWVDRTSHGSPKKSRMCATMSSS
IGKWSLNKCSELHGYVCKRMTVSVVETPREPHYIGGCPEKWLYFGHKCLLLHLPDSPKEG
KSWRDAQSICSSFDGSLVAIEDEIEQAYITMLLQGSFVGVWIGLRDEDTMKWINGRPVIY
TNWSPVEPRSYPIDEEWLSGVADEPLCTVLSNNHNFHLTGKWYDEKCSDSEYGFVCQKPQ
VSGPHSVSLYYHHPFPENIEYRSSSYKALSGNMSWEDALTNCHEKGSKLVSITDAYHQAF
LTVLVNRLAVPHWIGLYSSESGINYRWSDGSEIVYTHWDTADDEDDYVSEVCVYIDVNGG
WRRADCKTLLPGALCYVSPTPPSSESYISDKIVCPSSWVNFEQWCYNFEHVIEKHTFEES
REHCRHLGVSSNLLTITSKKENDFILEQLWSSGFIHQSIWLGMYFNIDTNSMERVDSLKS
DYTNWANKGPDVKQMTADTCVSTTVVGGVWHMSSCTERLGFICKSTADLITEVKGERLKD
LHHGVIPAAVLAAVLIFALLVVSMWFLYKRNYLCFHGIHTNSARFHSLPALRSAYYRQTS
SQATESDGNVLITDLETHSG
Download sequence
Identical sequences H2LGS7
8090.ENSORLP00000005176 ENSORLP00000005176 ENSORLP00000005176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]