SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005179 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005179
Domain Number 1 Region: 169-308
Classification Level Classification E-value
Superfamily C-type lectin-like 1.09e-31
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 318-455
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-28
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 3 Region: 467-603
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 4 Region: 618-717
Classification Level Classification E-value
Superfamily C-type lectin-like 2.12e-22
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 113-171
Classification Level Classification E-value
Superfamily Kringle-like 2.77e-22
Family Fibronectin type II module 0.00083
Further Details:      
 
Domain Number 6 Region: 1-113
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.07e-16
Family Cysteine rich domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005179   Gene: ENSORLG00000004132   Transcript: ENSORLT00000005180
Sequence length 726
Comment pep:known_by_projection chromosome:MEDAKA1:3:12992004:13005847:1 gene:ENSORLG00000004132 transcript:ENSORLT00000005180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCIKADHSSLVLEDCQRPTLRMLWQWVSSHRLYNLGTGMCLGLDILNTTHPLGMFECDKA
YTMMWWRCRGNTLYGAFQWKVTGAGRLVVVKKSDYYEWKRHRTPREGPCSYPYEDIHTLL
GNANGMPCVFPFNYNNKWYSECTTEGREDNLHWCSTTPRYDRDERWGFCPVKDSSCERFW
ESNQELQACYQFNLYTILTWSQALATCQAQGGNLLSITSMAEQKYIRDRLSSVGTMVWIG
LNHLKEGQGWQWSDGAPLSLVNFIPALPASPLQVNRECGVYNSAYDENWQSLSCESALPY
ICKKMPNDTRRAEPLENWQYIHTKCDDGWWPHNGFCYRVLPDSEAGSWQMSSEACSSQGA
NLTSIHSLSELEMLLFLLANVSGENLEVWIGLWKPLSSPAVEWSDGSPVTLTLWQQFQPV
HNLTETPLCAKLEKKKGNWLLVSCDERLSAVCRRESRSPVQHSETWDEGCPVKGGGWKRH
GHSCYTVTSHEQNYEDALMGFYCKAPLLTVENRFEQTFVNSLLSASGANCSRDYWIGLTD
RENKGEYSWLPLNGSSPPLTFTNWNKHQPVSGGGCVAMSGGPALGHWEVKDCKSYKALSV
CEQSVSSYHGVELPEHHIDAYAPCPPGWESQSGLLHCFKVFHDEKVLMKRSWVEADFFCQ
ALGAQLASFHHHEEQDFVNKHLSTMFEGTEGRWFWLGFNKRNPEHPGVWEWSDGSPPACI
LIMCLH
Download sequence
Identical sequences H2LGT0
ENSORLP00000005179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]