SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005210 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005210
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Bet v1-like 7.42e-29
Family oligoketide cyclase/dehydrase-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005210   Gene: ENSORLG00000004161   Transcript: ENSORLT00000005211
Sequence length 236
Comment pep:known_by_projection chromosome:MEDAKA1:8:6448259:6450431:1 gene:ENSORLG00000004161 transcript:ENSORLT00000005211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKTSLFVKALLDLNEVHFYTAARGIRGAQLSRHLSSLIARRSSLQLCPVSPLNTPSR
SFINLAAAISPRRVEYTESRTLEYTPEQMYNVVANVEKYQYFVPWCKKSRVIKGRNGNVQ
AELEIGFPPITERYTSDVTFDPNRQVRAICTEGSLFNHLETIWRFSPGAKDQPNSCLVDF
LVSFEFKSLLHSQLASMFLDEVVKQMVGAFESRAAALYRNHTSAIIRRQPAISNSL
Download sequence
Identical sequences H2LGV8
XP_020560804.1.28442 ENSORLP00000005210 ENSORLP00000005210 8090.ENSORLP00000005210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]