SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005246 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005246
Domain Number 1 Region: 562-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 491-537
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 87-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000529
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005246
Domain Number - Region: 618-675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000222
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number - Region: 443-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005246   Gene: ENSORLG00000004192   Transcript: ENSORLT00000005247
Sequence length 822
Comment pep:known_by_projection chromosome:MEDAKA1:9:7832925:7839222:1 gene:ENSORLG00000004192 transcript:ENSORLT00000005247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHQSFQICCLQSSLILFLFIKFCLRINCMWGSYGSWSECDPCTKLQTRSRAMVVYAQFGG
NPCSGMRSESRPCETTQGCPLDDGCRDRFRCRSGKCISKSLVCNGDQDCEEDGLDENGCT
NRNFVTCEHTMTPPNVNLVGLGFDVVTGKRRGSVINTRSFGGQCRTIFSGVHKNFYRLPL
STIQYNFLVKVQNDFSDEMFSSKWHYAKDVVNRETVTGTTKGYSNYDFHETHDTSQYHRL
LVLKNDIEVVQFQSNSPQYIPIAEEFWKALAKLPSVYDYTAYRKVLERFGTHYVSQGTLG
GFLKIIMSIDSESEKYLAVESKKFHECEKKVRFILIFPLIITKCKKGDKTTITPREGYST
NNVVAKVDVEGGGLSHSAALQRMQLDDASKNWEMYSNWADSIRSFPKIIKQKLRPLSELV
KDVQCAGVKKLYLRRAIEQYRAENDPCHCQPCRNNGIAVMDGDECKCICKPGTSGVACEQ
GTEVEGQQGVIHGSWTCWSAWSTCSRGQRSRSRRCQNPAPQNGGQHCIGDTVEMSSCDEE
DLEYLKTMEPQCFDNTLPPSQKCETPPALINGFIMNPKDVYLVGGRVEYSCIAGFHVLGN
SILECSVDQTWSPSLGQCTASSCKLKFLNEEVLASPLKPSYDIGEAVTLSCPVGRTLQGE
DRILCDSSLNFSPDPAEITCSQEETPPSPITPTVSCEAWEKPSRDKCICRIPHECSPSLD
ICGTLPGSGKLIPMTVCKMHALKCNKKNFEIAEYSDCVWPQHTTSSCRCKELAECLNSGI
NVCVRVGEDDTASTQTMSECEAGVRRCNGEKVSVVSILPCAS
Download sequence
Identical sequences H2LGZ3
8090.ENSORLP00000005246 ENSORLP00000005246 ENSORLP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]