SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005581 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005581
Domain Number 1 Region: 51-192
Classification Level Classification E-value
Superfamily TRAF domain-like 1.44e-21
Family MATH domain 0.023
Further Details:      
 
Domain Number 2 Region: 8-61
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000268
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005581   Gene: ENSORLG00000004449   Transcript: ENSORLT00000005582
Sequence length 196
Comment pep:known_by_projection chromosome:MEDAKA1:13:9297153:9327467:1 gene:ENSORLG00000004449 transcript:ENSORLT00000005582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVK
LTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFEESTLGFGYPKFISHEEIKKRNYIRDN
CIFIKASIEIPQKIMG
Download sequence
Identical sequences H2LHW4
ENSORLP00000005581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]