SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005597 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005597
Domain Number 1 Region: 30-211
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-63
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005597   Gene: ENSORLG00000004459   Transcript: ENSORLT00000005598
Sequence length 224
Comment pep:known_by_projection chromosome:MEDAKA1:5:7847348:7870272:1 gene:ENSORLG00000004459 transcript:ENSORLT00000005598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSQEQSVCLGLWMVLLLGAGMEEAVEGCSCHPSHPQQLFCSAEIVIRAKISGEKIVSP
SNSSSPYMKMIQYEIKMIKMFKGFDRAKDIQYVYTPVFSSLCGVKLDSNNKAGYLLSGSM
WNDGRVSIGQCDLVESWDNLSLSQKKNLNYRYQLGCECRINTCYTVPCASTGENECLWTD
WLLDNSLNGEQARQYACVRRSDMSCSWYRGGPQPDKDFLDMTDP
Download sequence
Identical sequences H2LHY0
ENSORLP00000005597 ENSORLP00000005597 8090.ENSORLP00000005597 XP_004068700.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]