SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005635 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005635
Domain Number 1 Region: 246-292
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000429
Family Fibronectin type I module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005635   Gene: ENSORLG00000004487   Transcript: ENSORLT00000005636
Sequence length 308
Comment pep:novel chromosome:MEDAKA1:19:4057058:4061669:-1 gene:ENSORLG00000004487 transcript:ENSORLT00000005636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLLPLLLLSRLCKFVSYADAGTFPAPDSFYPISGTASPPSDDGSSPKILLERPFVYFGQ
TYDNIYVNNNGHLTFNASYSSYSPQRFPLYGSIDLIAPFWTDLDNRQTGLVLYNQYTNGS
VLQRATRDINSYFPNLNFSADWVFVATWYEVAYFGTAGTVSHTTFQAVLISGGQKSFVLF
NYGSIASATQNVQNLQAGYDTINSFHHFTIPGSFSSSATGNNSTFSLSSNVNVTGRWAFQ
IDKGPEGCTFDGKRVQLGEFFWSDSNCTQKCTCTTSGIHCISELCSFSEICILTNFQFLC
FNVIGKLS
Download sequence
Identical sequences H2LI17
8090.ENSORLP00000005635 ENSORLP00000005635 ENSORLP00000005635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]