SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005668 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005668
Domain Number 1 Region: 954-1013
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000965
Family BSTI 0.07
Further Details:      
 
Domain Number 2 Region: 576-636
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000294
Family BSTI 0.058
Further Details:      
 
Domain Number 3 Region: 1340-1398
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000103
Family ATI-like 0.036
Further Details:      
 
Domain Number 4 Region: 626-680
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family Fibronectin type I module 0.063
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005668
Domain Number - Region: 246-294
Classification Level Classification E-value
Superfamily FnI-like domain 0.00178
Family Fibronectin type I module 0.022
Further Details:      
 
Domain Number - Region: 1004-1060
Classification Level Classification E-value
Superfamily FnI-like domain 0.0136
Family Fibronectin type I module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005668   Gene: ENSORLG00000004509   Transcript: ENSORLT00000005669
Sequence length 2010
Comment pep:known_by_projection chromosome:MEDAKA1:19:4128988:4145007:1 gene:ENSORLG00000004509 transcript:ENSORLT00000005669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNYFFFLALRIYFLLSLLFSQSIQRYLGSLYPIYGTASSRSDDGSSPQILLQKPFAYFGK
TYNYIFVNHNGHLTFDASYSSFTPQRFPLYGIRDLIAPFWTDLDNRQTGLVLYNQYTNSS
VLQQATRDINSYFPNLNFSADWVFVATWYEVGYFGTAGTVNKTTFQAVLISGGQKSFVLF
NYGSLAPTVWNVQNLQAGYDTINSFHHFTIPGSFSSSATGDNSTFSLSSNVNVTGRWAFQ
LDSGVRGCQFNGEPVQLGDSFWNDSSCAQKCTCTRAGLQCSNQPCSFSQVCMPASFQFSC
QTVPRRTCTISGDPHYYTFDNKVFSFQGTCTYVLSEQCQNELPYFRVEGKNEHFGNTRVS
WTGLVKVFVYNETIELVKRTTGKAKVNGNFVATPFSLLQDRIQVYQSGMSMIVSTNFGLM
VAYDISYYLRISLPYTYQNATCGLCGNFNNQPGDDLRTRDGEVVSSDVVFANSWRASGDE
DPGCDAQCEGLECAGCTAAQTALYSNNDHCGILQNSSGPFAACHQTLPPQNFVDSCVYDV
CVGGGYQPILCQSLGVYASQCQQNGIQPQNWRRPGFCEIPCPANSHYESQATGCPPTCVN
PNSTQNCPLPVQESCVCDTGYVLSAGECVPYAECGCSFEGFYYRSGQTVILDEDCGRRCS
CTAGSMTCSPHGCGPHESCSVDDGERGCRPNGYATCWIRGPGSYQTFDGLTYQYPGACRL
IIAKEMGLSGHPHFNVITEKVPNILQDFSNVLKVRVQETEVTINMDNNKVWVDGQLYKLP
FTSGSNQIRIFHSNTHSIILRTSFGLTVQTVWPHFVRVTAPVVYSSSLGGLCGNYNDEPN
DDFQTPNGTLVHSSQVFGDSWREGSLASHCVENTVLNPLNYSSTEFCGILSSPHGPFTPC
WPVVDPSQQVDVCVDILRRSEDPESTLCEVLRDYALMCQQQGVSLGEWRNTTGCAATCPS
NSHYELCGTSCPSTCPSLSFPFSCDSPCQDGCQCNDGFVLNGNQCVPPTSCGCYHEGRYW
QSGQQFWDGEECQSLCSCNGVTGVVSCVPHSCGPDEACRVVDGEFGCHPNPHGTCSASGD
PHYLTFDGKTYDFQGTCRYVLAEVCNSSSGLHQFSVEAKNEPLNGLPVSITAEVAVTVWG
YKVWMFSNNRVEVDGITRNLPFVLNGTISVFASGYQTFVRTSFGLSVMYDGWSTVSISVP
PDYRGNMCGLCGNFNDNPNDDFHTPDGAAVTTPDAFGAAWKVPGNYTCSDGCGSSCPRCT
SGIGHFNHWVQMTLQLLPNQPPKFLSIHVFSLFLLTLFFLFLVYLNQSLVGKNPSTEEHL
SPECHSLFFVASFKHSFAQCSINCPANSHYELCGTDCGRTCASSTDATCEHACSEGCFCD
EGFVRSGTTCVPEGSCGCQYDGFYYSVGQSFWKDGCSELCECFASDVVHCAAASCTAAQQ
CTIKGGQLGCYDGMSTCTVWGDPHYITFDGALAHFQGTCSYIITETGSHGNNHTQFEVVA
TNNHRGNNHVSFVSLVDIHFSKDAESVHVRIGPNRRVKVDGSDVSLPTTVGAIAQVSTQE
GFVVFDAADLIVQFDGQSTLLVRMSQYYQNKVSGMCGNFNGDPSDDKVKPSGTLAQNDTE
FGHSWKSPTSQPGCGSTDEIKGDGHCRFSQEYSELCSIITNTSGPFSACHLHSDPQPFFS
SCVYDLCLYTPANGMLCSAVSAYEKTCTVLGLNIPEWRPALHCGTAESDPCEQLNCTENE
WCGEKHGAYGCFCDEHHHRPNNDSYVIYSSITCVSSLGTLSLSRCQLFEAGFHLSDLHLR
DDSCNGTLQDRRLVFYSNNVWDSSHRLSKSNGTHFIYENSVQGDVDPHDSIISREKSLHL
LFSCVYPLAQTLSMDVDIVFCYVISIVNKRLPSGEGHYHLRMIPYEDPNYQSLLNRNRNL
KMEINQRLYIEVLTEEVDEQQISTILECATPFSDVSYPVRWDLISNECPNPGDGTVELVQ
NGISTVARFSFKMFTFTNYSSIQLHCQIHL
Download sequence
Identical sequences H2LI48
ENSORLP00000005668 ENSORLP00000005668 8090.ENSORLP00000005668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]