SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005762 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005762
Domain Number 1 Region: 88-137
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000102
Family Hairy Orange domain 0.002
Further Details:      
 
Domain Number 2 Region: 21-83
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005762   Gene: ENSORLG00000004584   Transcript: ENSORLT00000005763
Sequence length 231
Comment pep:known_by_projection chromosome:MEDAKA1:17:5564636:5566824:-1 gene:ENSORLG00000004584 transcript:ENSORLT00000005763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTGPLERPAGAPEKVRASSESRKSSKPIMEKRRRARINESLAQLKSLILDALKKDSCRH
SKLEKADILEMTVKHLRNLQRLHVSAAVHSDPSVLSKYRAGFSECVGEVTRFLSSYEGVN
SEARTRLLSHLASCVSQIHTVNVCGPHPGAPGQSAALLPAASGPQTTKSCSQMPASTDTI
TLFAGFQVVPSPDGQFSLLVPSAGLTPLGMHSGGAPAAAPALTSDSVWRPW
Download sequence
Identical sequences Q1L7T3
ENSORLP00000005762 8090.ENSORLP00000005762 NP_001098284.1.28442 ENSORLP00000005762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]