SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005787 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005787
Domain Number 1 Region: 119-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.26e-31
Family DEP domain 0.005
Further Details:      
 
Domain Number 2 Region: 31-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.38e-28
Family DEP domain 0.0013
Further Details:      
 
Domain Number 3 Region: 308-388
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000373
Family PDZ domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005787   Gene: ENSORLG00000004604   Transcript: ENSORLT00000005788
Sequence length 407
Comment pep:known_by_projection chromosome:MEDAKA1:16:6280713:6307858:1 gene:ENSORLG00000004604 transcript:ENSORLT00000005788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRIGSTMQKKAAELERLAEVLVTGEQLRLRLHEAKVIKDRRHHLRTYPNCFVAKELIDW
LLEHKEASDRATAIKIVQKLMDQSIIHHVCDEHREFKDLKLFYRFRKDDGTFPLDCESKV
FMRGQRLYEKLMNTENTLIQSRQEEGSLFERSLVASEFIDWLLQEGETPTREEAEQLGRR
LLEHGIIQHVTNKHHFVDGPLLYQFRMNFRRRRRLLELLHERSRSIPENHDSPFCLRKQQ
SDGGNSSFLSVQAEGPPVLCNPKSVCCQHQVPNCVSNCDHIKLRLKTVLKVVKRHVTPEE
LQKPGGSFAKKTFTIIGDAVGWGFVVRGSKPCHIQAVDPSGPAAAAGMKVCQFVVSVNGL
NVLSHDYRTVSNLILTGPRTIVMEVMEEVQDNLHPSKIKEELSFSWT
Download sequence
Identical sequences H2LIG3
8090.ENSORLP00000005787 ENSORLP00000005787 ENSORLP00000005787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]