SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005880 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005880
Domain Number 1 Region: 354-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005880   Gene: ENSORLG00000004672   Transcript: ENSORLT00000005881
Sequence length 860
Comment pep:known_by_projection chromosome:MEDAKA1:14:11508756:11513685:-1 gene:ENSORLG00000004672 transcript:ENSORLT00000005881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMDQMFDLMLHVCVFLVAFARLSIWPSFHVALSNGSVFVDFSTKSNSSIVSNLSLSLVD
MGTNATLLTRTLPSNQPVGRVEFNCSCFLYAGTFRFLLRQTSITPAFHANETDGVSVESL
TWWWSSELEVQWPTFHIAVERAANRSDSFQVGISMNEHFQACSSSNKDVLLLEVTYMEYN
QIGRNSIDKIRARVQRPIKALRSQIIDFSCAFPFTEKDFIRVTLRSPHTAQEVKSTEPLY
LSRIFFYKLLVENANAYKSGCVGTMTVKMITPPCAHISGKVLLYSDAPGAGSGAEKSSSP
PLAFNWLTQGENETEFNCSVFHPGKSKYCFRFVFNFSRSPSPAQTCLVVYRSTEQWGPWQ
PWSVCSASCGEAVRERVRECLLPSGVRGLQCSGMIKEQSLCSLEDCVVSPSPSPSPPPVP
VGVSFLGGNMIVVLGISLCLSVIMATVVVTVWRRFCQTPQCSSVRRGSIHSPGGRKLSDE
ASICGHSLQRPSLSDCPGSSGGVAVPADANYRGSQPLSPTLVLPLPQDPERLSPTGQKVL
PSVFGYKLAQQQLKEMKKKGLKEATQLYHVSSSPVHDTVVEKSPNSSSVLSHAELAQSTL
PLSLQDNDDHVCIATPLSKLPAQSSRITPDRLSPKAGLAPGPPVSARSSRGGGGDAESIK
NPTFRRTSSFSDTKFYAASSAQSRHFRERSMTQVSPPHSYIFFSTYFMWDFGLSQKGVLG
AKEDGRDTLTALIPSQKMEFQSGLEAIPIEVTKKSPGIRGPASKPTKSHGTNHLSVDQVE
RAEQNWNRRGPSPIQRNILARKLKEAQSCSGARACKRSSSFNLSSSEQRKGRCRSLPISE
DHSGGSPYRLSEAEQRMLDL
Download sequence
Identical sequences H2LIP9
8090.ENSORLP00000005880 ENSORLP00000005880 ENSORLP00000005880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]