SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006238 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006238
Domain Number 1 Region: 729-944
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-106
Family Thrombospondin C-terminal domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 602-727
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.15e-34
Family TSP type-3 repeat 0.00000402
Further Details:      
 
Domain Number 3 Region: 534-604
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000994
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 221-264
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0000000000000157
Family Assembly domain of cartilage oligomeric matrix protein 0.0015
Further Details:      
 
Domain Number 5 Region: 463-545
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000144
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 21-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000107
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 7 Region: 371-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.025
Further Details:      
 
Domain Number 8 Region: 289-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000272
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006238
Domain Number - Region: 431-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006238   Gene: ENSORLG00000004949   Transcript: ENSORLT00000006239
Sequence length 961
Comment pep:known_by_projection chromosome:MEDAKA1:12:7797925:7813458:1 gene:ENSORLG00000004949 transcript:ENSORLT00000006239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPHNRGPCCLLLCFLCVHGVGRWRTKFHAHHLLTFTTLSYFAKKTNYLLQGGLIEQGVNE
AFILTSFKLQPKSGTTVFSLYNPRDNSKYFEFTVMGKLNRAVLRYLRSDRRMSSVTINNL
VLADGQKHRLLFHLRGLQQQGPGGLELHLDCRLVETVRDLPAAFQGLPTGYGTVQLKTMQ
PREQESLDELKLAVGDSFESVASLQDCHFQQRDSVQTLGVNTKQLSNQMMELTKVINELK
DVLIQQVKETSFLRNTISECQACGKCLHCFSENKAAQYLGGSEVVKPKCSPGVCFRDDMC
IETANGVECAACPDGYTGDGFNCDDVDECQFNPCYPGVKCVNTAPGFRCDACPLGYIGLP
VEGVGIVFAQTNKQVCDDIDECKGPSNGGCPANSNCENSMGSYHCSCKTGFIGDPVKGCK
PEVSCGNSLTNPCHANASCVLERDGSISCQCGIGWAGNGYLCGKDTDIDGYPDEKLKCKD
AHCRKDNCIYVPNSGQEDADRDGQGDACDEDADGDSIPNELDNCWLKPNVDQKNSDSDSH
GDACDNCRLAKNPDQRDTDGDGKGDACDDDMDGDGLKNFLDNCQRVQNRDQLDRDGDGVG
DACDSCPDIPNPNQSDIDSDLVGDSCDTNQDSDGDGHQDTKDNCPYVINSSQVDSDKDGL
GDECDDDDDNDGIPDVLPPGPDNCRLVPNPDQMDDNDDGVGDVCESDFDQDKVIDRIDIC
PENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFSGV
DFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAV
KSKTGPGEHLRNSLWHTGDTNHQVRLLWKDPRNVGWKDKVSYRWYLQHRPQVGYIRARFY
EGTELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFRAQHAVDP
I
Download sequence
Identical sequences H2LJP8
ENSORLP00000006238 8090.ENSORLP00000006238 ENSORLP00000006238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]