SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006260 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006260
Domain Number 1 Region: 177-387
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-55
Family Reprolysin-like 0.00083
Further Details:      
 
Domain Number 2 Region: 480-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000837
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 3 Region: 791-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006260   Gene: ENSORLG00000004966   Transcript: ENSORLT00000006261
Sequence length 846
Comment pep:known_by_projection chromosome:MEDAKA1:2:28621124:28635384:1 gene:ENSORLG00000004966 transcript:ENSORLT00000006261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRTDGVVRTIDRIYHGGGKVGYLVYLDGRRFQLDMERDESVLSDHFSPQYVMALMGQSSA
PSQRECAYRGTVNSEPESLAVLNLCGGGLEGFFAVNQSRYTITPIIRARGHEHDVRALQD
KDAESALHVFTRESFRFEAANDGRESCGTRDRARRGRKRKPHNREDEGGARRRRSVSRAR
HVELLLVADDSMAKKYGKDLNHYLLTLASIASKLYGHASIENPIRLSVVKLVVLSEREKG
LEVSKNAAATLKSFCKWQNQQNPLDDDHPHHHDAAILFTRQDLCGHHSCDTLGMADVGTI
CSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDSKFCEERFGVNSDKRLMSSILTSID
ASKPWSRCTSSTITDFFDDGNAECLLDSPRQSLLGPEELPGQSYDAVRQCRLAFGPEYTV
CHGMDVCSRLWCSVIRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTRKKHYSTSNH
GSWSSWGSWGSCTRTCGGGVQFAQRLCNNPPPRNNGRYCTGKRAIYRSCNVTPCPPSNKT
FRQEQCEARNGPQTDPKGVKTFVEWVPKYAGVLPKDVCKLTCRAKGTGYYVVFSHRVVDG
TECRPYSSSVCVKGKCVRTGCDGIIGSKLQYDKCGVCGGDSTGCIRVVGNFTKKSKGYTD
IVKIPAGSTHIKVRQHKAKDQTRFTAYLAFRRPNGEYLLNGKFMISTSETIVPLNGSLLN
YSGWSQRDEWLHSMGPGALQEPLVVQILATDAKKPLDVRYSFLMPRVTSPQQLLAPKLTQ
SQSTTTTSSTTGPQWVTGSWMACSRTCDTGWQSRTVQCKDQHGKLSKNCLIGVRPSAFRH
CLVKKC
Download sequence
Identical sequences H2LJR8
ENSORLP00000006260 8090.ENSORLP00000006260 ENSORLP00000006260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]