SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006294 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006294
Domain Number 1 Region: 206-417
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.94e-55
Family Reprolysin-like 0.0007
Further Details:      
 
Domain Number 2 Region: 510-566
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.09e-16
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 826-878
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000929
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 876-935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006294   Gene: ENSORLG00000004990   Transcript: ENSORLT00000006295
Sequence length 935
Comment pep:known chromosome:MEDAKA1:2:28644898:28648942:1 gene:ENSORLG00000004990 transcript:ENSORLT00000006295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLHVSIVALCVGAALCTWEESTVVPVRLEPDQREPWRTLSAEEEQKVGEMRVYQLDVF
GKQLILRLEPDQTFLAPGFVFHVVGSPESVPALAGSDSGSEPGCFFSGTVNGEAHSAAAL
NLCRGLSGGFFFEGNEYFIQPLDSSELDQVHSIRRRSRAAHKEEGSSKCGVNEDEERMPK
NPGEEASHGAPNAEQTARQRTRRFVSTPRYLEIMLVADQSMAEFHGAGLKPYLLTIMAVA
SRLYRHPSIHNSISLAVVKLLVVYEEEKGPQVSSNAAMTLRNFCQWQRQHNPTSDRHPEH
YDTAVLFTRTDLCGAKNCDTLGMADVGTVCDPERSCSIIEDDGLQAAFTVAHELGHVFNM
PHDDAQLCSGVNGPHWGSHMMASTLSNLDQQQPWSPCSALMITSFLDNGYGQCLLDKPVK
PQPLPQPLPGTVYDVNHQCRLIFGDDSKHCQEHSSTCAVLWCTVTLPSGLMVCQTKNFPW
ADGTACGTESYCLAGQCLTKSQAAKHQQTPVNGGWGLWGPWGDCSRTCGGGVQYSFRSCD
NPLPKNGGKFCEGKRIQYRSCNTETCPDTNGLSFREEQCLAHNDMSAQVSLGSGEGVEWV
PKYAGVSPKDRCKLVCRAKGTGYFFVLKPKVADGTTCSPDSTSVCVQGQCVKAGCDRIIG
SNRRFDKCGVCGGDGSTCKKVSGSLDRARPGYQDIITVPAGATHLDVKQRAPGNGRNDNS
YLAVRRQDGTYLLNGDYKLMTMETDIAMRGALLRYSGSSATLERLRSFAPLPEPLTIQVL
SVGEAPRPRVKYSYFAPRPNNGASASNNNGARRQSINAIRDVGTADWTLREWGMCSQTCG
GGIQQREVVCLDPQGRPSLDCPEELRPLASRPCASQECPTWLLGEWSGCSKTCGRGFRKR
QLSCIGHNGRTLTNDSCDSKNQPRPLLELCNQTAC
Download sequence
Identical sequences H2LJV1
8090.ENSORLP00000006294 ENSORLP00000006294 ENSORLP00000006294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]