SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006303 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006303
Domain Number 1 Region: 522-594
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-19
Family I set domains 0.0076
Further Details:      
 
Domain Number 2 Region: 259-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000759
Family I set domains 0.061
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000562
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 791-854
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 33-95
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 158-216
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 917-972
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006303
Domain Number - Region: 853-913
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00109
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006303   Gene: ENSORLG00000005000   Transcript: ENSORLT00000006304
Sequence length 1009
Comment pep:known_by_projection chromosome:MEDAKA1:18:11028088:11038520:-1 gene:ENSORLG00000005000 transcript:ENSORLT00000006304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PICKNVTFGNQLHPGLILELEPANLLPCNETSGSHRWKTGEWSSCSATCGVGLMTRAVAC
THRPFADSNRTVILGEGDCHLPKPSPVQACNRFDCPPLWDLHPWGQCSQSCAGGVQRRRV
LCKQRLADGSVMELPDSFCPSRRPPSQQQCEKQDCPAQWITTDWSQCSVTCGHGIQALQA
VCRKLGANRQYVTVDLKNCSKLTKPSRFRPCFPRNCEGKLNVVADSLRPDPIMLPLKKVY
IQWRKGKRVHLVVGGYAYLLPWTTLVLRCPSGSFRKGHIRWLKDGKPLVNLSVTSQGYMK
IQQVQPSDAGVYTCVTGQAQEHFVLLIIGSKQKLFAPESLLLGSSKNRRPASPRGGLQEP
PVSLNRYDNLVELLLGLKSSSQNEKYLVSKPHWSQINRSTVEDGRSSEFSIPVLLTADSQ
RLDELMQDFSEGLRGAQAERLVQLLSELITTQGETNESTLHPMERATSSTQGPMVYKPNI
KAHISRAKIPVIIQRPKKVGVSPASDSVIYVGAPVVLQKAAATLELRCEALGDPHPSVTW
TKNGKEVQLSSRVELLPSSSLRIQSPSKGDEGLYTCTARNHLGSASLSSYLQMTIKTHYD
KKKGVFNLFLWHFSDDGGHIIGKYDERATSSLICSILLLPLVDLCFLCRSWNLDLNCRAG
QLAGESVNRELRYWWGDKGVGVASNELIPLCRNYPKITTIVSTGFIPVIVKLLCSRQSAA
APGFPDAVALFLPIRQQLEAPSNISKCNFFCFQFNLLLGGKGKNCVHSNRTGGSGSVCSE
RSNRSQAAELCAGQGCHLRWHLDAWSSCSASCGGGSQTRRLRCLKGRSREVEIRQCLLAG
RRPTNTRLCNVGPCARWVTASWGPCHGQCVGPSLATQHRHVYCQDTNGTKLSSRMCSAFR
RPSSVKNCSTEACALRWHVGAWTQCTATCGRHGFQSRQVTCKHHRTGKATREHHCMWSPR
PPSWQRCNILSCSRRECQDSTRYCEKVRQLELCPLPQFKRRCCVSCRNT
Download sequence
Identical sequences H2LJV8
8090.ENSORLP00000006303 ENSORLP00000006303 ENSORLP00000006303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]