SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006517 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006517
Domain Number 1 Region: 249-452
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.08e-45
Family Reprolysin-like 0.00065
Further Details:      
 
Domain Number 2 Region: 541-597
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000275
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 1097-1153
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000235
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 947-1006
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000128
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 888-945
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 1012-1073
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000119
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006517
Domain Number - Region: 837-885
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0034
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006517   Gene: ENSORLG00000005170   Transcript: ENSORLT00000006518
Sequence length 1197
Comment pep:known_by_projection chromosome:MEDAKA1:16:9093538:9153496:1 gene:ENSORLG00000005170 transcript:ENSORLT00000006518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYEIVAPYEVSHEGVYISHRVSHHERRRRRRSLTTEAQSSNKGGSSEKVHFRLSGLGQDF
HMELWEASESLIAPGFTIQVLGKNSTKSLRAYHQDDLCFYQGSLRSRVNSSVALSTCMGM
SGLIRTQHADYFLRPVSRSLAERENFTAPVTHQPHILYKRDGVTWLKQMYHQPRALQKRS
ADSFQHLSPRPSKLSDYRPGEKQRQHFCGRKKKYMPKPPEENIYVLPDEYKFIPRNKRAV
LSKNRDIQRLNVETLVVVDRKMMDNHGHDNITTYALTVLNMMTKVDKGGKISCFFVHAIF
FLSSQDGLMINHHADHTLNSFCQWQSTLGGREGRHHDHAILLTGLDICSWKNEPCDTLVG
FAPISGMCSKYRSCTINEDTGLGLAFTIAHESGHNFGMVHDGEGNVCKKSEGNIMSPTLA
GHNGIFSWSPCSRQYLSRFLNTAQALCLSDEPKAAKEYRYPEKLPGELYDADTQCKWQFG
EKAKLCTLDFKKDICKALWCHRVGRKCETKFMPAAEGSACGPEMWCRRGQCVKQGDEGPG
PQHGHWSEWSSWSACSRSCESGVTSRERQCSNPRPAYGGKFCEGSAKSYKLCNAVDCPPN
STDYRAHQCAEFNSKQFRGWYYTWRPYTKVDDQDVCKLYCFAEGYDFFFALASKVKDGTL
CSKDNTNVCVDGLCERVGCDSVLGSTAVLDACGVCKGDNSTCKIYKGQYTKQHFTNQYYG
VVTIPAGARSIRVMELNTSSSYLAVRDNHRHYYLNGHWTVDWSGRHSIAGSIFEYKRPYN
RPESLLSAGPTNESLIIEILLQGWNPGVRWEYTLSNTDDRLMKNPSKHNYSWAVVQSLCT
VTCAGGRMSTNASCYKDMRVQVNTSYCNPKMKPATGVMPCNTQPCPHSWSVGEWGVCSRS
CGGGEQTRQVQCVQRTNQNNVDARADSGCAQPAPVRRQTCNTHSCPPVWSTGPWSQCSHK
CGNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQ
ECSAKCGQGYQARFIKCAEKDTAGKYRELPAKKCHHVPKPTVDLQRPCIVAECRSHTTPA
VHQWVTPLRTYPPQPLPHSPPEWQSSPWSHCTVTCGGGVQSRTVYCQVQGKLSSGCAPHL
KPPMSQACNTNFCPQPEKKDLLCRDYFNWCYLVPQHGVCNHKFYGKQCCQSCSNSNL
Download sequence
Identical sequences H2LKG6
8090.ENSORLP00000006517 ENSORLP00000006517 ENSORLP00000006517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]