SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006792 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006792
Domain Number 1 Region: 315-380
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 436-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 382-432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006792
Domain Number - Region: 265-317
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00012
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006792   Gene: ENSORLG00000005389   Transcript: ENSORLT00000006793
Sequence length 532
Comment pep:known_by_projection chromosome:MEDAKA1:17:6205265:6234263:1 gene:ENSORLG00000005389 transcript:ENSORLT00000006793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTQNVNSSYCVGSPKQYQLCLKKPCPSPSVSFKQHQCSQFNSKVFGISYYQWIPLYSADD
VSISNKPCDLQCTTDGGERQLLVPAHDGTFCHDGKHHGVCIDGICQPVGCDGQLYSTKVV
DRCGKCGGNGTTCQRVTGSYRKAFTQLGYVFITNIPAGASDIQIIERHKTENILALSDEA
GRFFFNGNPVFDNPQNFHVAGTVFKYRRPSSGFSEGLEYMTAQGPTVQALNVMVPLMNIK
HKTVSIVTLKSSSGNEICVQTNKMYNPYAPCSSTCTAGLSSSFAMCVRYDGTEVDDMYCD
SLTRPEPTHEFCSGKECPPRWETSGWSQCSRTCGEGLQYRTVRCWKMLSPGLDSSVYDSL
CLSHDLHRPANRKPCFGQSCGPQWEVSEWTECSARCGSQGLRTRDVRCSSDRRMCNQTSQ
PADREECEGPPCDRRWTVSDWGPCSGACGDGRMLRTVTCRSSEGLVMSEEQCDQLLRPLT
VYPCGDRDCAPHWVEQEWQQDKPTANCALVLKVKLCSHWYYRQACCQACKTP
Download sequence
Identical sequences H2LL82
ENSORLP00000006792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]