SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006795 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006795
Domain Number 1 Region: 285-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006795   Gene: ENSORLG00000005391   Transcript: ENSORLT00000006796
Sequence length 339
Comment pep:known_by_projection chromosome:MEDAKA1:10:13087143:13101515:1 gene:ENSORLG00000005391 transcript:ENSORLT00000006796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSERQTCGWWRQLLIVLVKLCLAFAGPLRPLNGTECTAKSPASYILVFTGHWSPQSFPK
QYPLFRPPAQWSKLIAVSHNHHFRLWEEGAAASLGVQKFAELGLTVELMKAGKEARKKRT
VGAMQRTAGIPNGIGHSSTEVHMQPRSSLLSLMVKMIPSPDWFVGVNSLNLCEGNHWKQE
VTVNLQPYDAGTNSGFTFSSPKFPTSPPENISKITSQVPNHPANSFYYPRLKELPAIASI
KITRQHRSANRQTVLSNHILPNSISPRRFSGKVTGNTLFTETPLDCEVSLWSSWGLCLGP
CSRGGIRHRTRYILLRPANAGSPCPELEEQAECVPYSCM
Download sequence
Identical sequences H2LL85
8090.ENSORLP00000006795 ENSORLP00000006795 ENSORLP00000006795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]