SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006796 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006796
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 807-868
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000759
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 578-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 699-752
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000759
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 750-812
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000562
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 645-695
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 7 Region: 520-580
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000628
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006796   Gene: ENSORLG00000005389   Transcript: ENSORLT00000006797
Sequence length 913
Comment pep:known_by_projection chromosome:MEDAKA1:17:6210496:6234272:1 gene:ENSORLG00000005389 transcript:ENSORLT00000006797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQSGAPVTPIWWWGEWSNWSSCSRSCGGGVRSQERHCLIQRLSTTQNVNSSYCVGSPKQY
QLCLKKPCPSPSVSFKQHQCSQFNSKVFGISYYQWIPLYSADDVSISNKPCDLQCTTDGG
ERQLLVPAHDGTFCHDGKHHGVCIDGICQPVGCDGQLYSTKVVDRCGKCGGNGTTCQRVT
GSYRKAFTQLGYVFITNIPAGASDIQIIERHKTENILALSDEAGRFFFNGNPVFDNPQNF
HVAGTVFKYRRPSSGFSEGLEYMTAQGPTVQALNVMYYNLNGKLSHITYQYTLPLVPHNI
SASEAVSSGPPHLYLNLTTEQVPETATGAQSGSRNQSRCEASAHCFNSLLEAEEPLEEDS
WISSRSSSGNEICVQTNNDLDKNVLLFKSFALSDVAPYTLRGDLHRNQTSVHSVKHTLTN
SQAPAAKDPDPDAHKTTAAQRAGTDRSDTTPTKLPIIHLQTNRSMVNGVYLYRPKALYIH
THIHTLVAAPLPTTFHQKQVIVLRVPFLSNDVPLQRRISPADMYRWKVSAHAPCSSTCTA
GLSSSFAMCVRYDGTEVDDMYCDSLTRPEPTHEFCSGKECPPRWETSGWSQCSRTCGEGL
QYRTVRCWKMLSPGLDSSVYDSLCLSHDLHRPANRKPCFGQSCGPQWEVSEWTECSARCG
SQGLRTRDVRCSSDRRMCNQTSQPADREECEGPPCDRRWTVSDWGPCSGACGDGRMLRTV
TCRSSEGLVMSEEQCDQLLRPLTVYPCGDRDCAPHWVEQEWQQCNVTCGRGLRRRRVVCA
GLERGTFREFPDSSCDPDKKPESTSSCFQRPCSKWFSTSWSQCSKTCGSGVQVREVKCYQ
GGELVTRGNNCYPLLKPETRQNCKIQDCPADAPADAFCQDKPTANCALVLKVKLCSHWYY
RQACCQACKTPPN
Download sequence
Identical sequences H2LL86
8090.ENSORLP00000006796 ENSORLP00000006796 ENSORLP00000006796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]