SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006805 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006805
Domain Number 1 Region: 397-786
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.27e-130
Family Ankyrin repeat 0.000000000427
Further Details:      
 
Domain Number 2 Region: 39-415
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.96e-110
Family Ankyrin repeat 0.000000148
Further Details:      
 
Domain Number 3 Region: 3836-3907
Classification Level Classification E-value
Superfamily DEATH domain 6.06e-16
Family DEATH domain, DD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006805   Gene: ENSORLG00000005399   Transcript: ENSORLT00000006806
Sequence length 4019
Comment pep:known_by_projection chromosome:MEDAKA1:15:17793053:17840624:-1 gene:ENSORLG00000005399 transcript:ENSORLT00000006806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSDSNASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLG
ASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVR
FLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKA
AALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAK
RGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSP
LHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKA
LNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGA
SPNTTNVRGETALHMAARAGQADVVRYLLKNGAKVDTKSKDDQTALHISSRLGKIDIVQQ
LLHCGASANAATTSGYTPLHLAAREGHEDVATMLLENGASLSSSTKKGFTPLHVAAKYGK
MEVASLLLQKGAPADPAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHAAAKNGYTPLHI
AAKKNQMEIGTTLLEYGADANAVTRQGISPIHLAAQEGSVDLVSLLLAKNANVTVCNKNG
LTPLHLAAQEDRVNVAEVLLNHGADINLQTKMGYTPLHVACHYGNSKMVNFLLENDAKVN
SKTRNGYTPLHQASQQGHSHIVNLLLQHGASPNELTVIGSTAQSIARRLGYISVVDILKP
LTDETLTSSRPSEKFRIYIPEIMNEFLDMSDDEVWANVPEILKEESFSDVDEGEDALTGD
TDKYLRPQDLKELGDDSLPQEGYMGFSIGARSASLRSFSSDRSNTLNRSSYARDSMMIEE
ILAPTKDTHLAVTRDYSSECMRRYSWTPDTMDHSHNTVSSPIHSGFLVSFMVDARGGSMR
GSRHNGMRIIIPPRKCTAPTRITCRLAKRHKLAYPPPMVEGEGLVSRLVEVGPAGAQFLG
PVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHQSDFRPEDLTELLAGMDEELDSPAELE
KKRICRIVTRDFPQYFAVVSRIKQESNHMGPDGGVLSCSTVPMVQASFPQGALTKRIRVG
LQAQPVPDDLVRAVLGNRATFSPIVTVEPRRRKFHKPITMTIPVPPRSAEGHPSGHRGDS
APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCHQIPETVSLA
SQLYRELICVPYLAKFVVFAKMNDAVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIE
VLEGKPIFLDCYGNLSPLIKSGQQLVFNFYSFKENRLPFNVKVRDVGQEPCGRLSFLSEP
KTSKGLPQTAICNLNITLPTHKKDMESDPDDETEKPERRHTFASLALRKRYSYLTDPAAK
TTDRSSPRTQPSSYPHKPVFSTRSYQAWSPVPVAIPGQTKSGFGSLSSSSSNTPSASPLK
SVWSINSVSPIKSNIPGSPASSVKSVSDTASPIRSYRTISSPIKTVVQQSQYPVQITPSP
LASPGRSAPDPGSMKGLSALSARISPITTSGGGSTVLDRISIGLTPPTSPKSSLNMFSSP
LPYKTVLGSSSGTPSSSSPIKTVPGLSSVRSFASDATGSARNLFSSFSSPLKSSTPPSAA
GLINGTLSPTQYRSLSPTPLLTSSLQERIQATTNAATSSVNAAFDEVEKTLNSCSAGYGT
LKSLSSSASSSYQSIRSSASGSLYAPLRSTPNATTAVTSSTTTVPVYSVTSVLPESQFKK
LPEVSSAAAALLSPRKSVPSEVNARNESSFARTLSPIKAPHLPPGIKSKTTSPLSSSQEI
LKDVAEMKEDLIRMSAILQTDPNSSSSSKGFRSDSPKEGKLEDEEPYRIVEKVKQDLVKV
SEILTKDVGKDGRVSPARGSLDDIHFSKIQVEQPPSNWSYPPRYETVVHQTGTKSSPDFS
LSKVVDYLVNDVGSSTFSKVPEGKHKTDEDRREGEGKEKHKRVLKPTIAVQEHKLKMPPT
NMRSSPSDREISKVADALFGSDTVLESPDDISHEQDKSPLSDSGFETRSERTPSAPQSAE
GMGPKALFQDMPAPPVITETRTEVVHVIRSYEPEDKTQPTMEDTHSVKYIDSGSKSQTQF
TSTGDPNKCSSVKVSPDEDPKGMRVKEETHITTTTRMVYHKPPGKEAASERCEETMSVHD
IMKAFQSGKDPSRELAGLFEHRSSNEEISQRVLEDVNSKPKVERIIEVHIEKGNKTEPTE
VIIRETKNHTEKEMFFYPGSRQDEEEPEELPSVFIDSSRVNTPMSQEDDSRPSSAQLIAD
DSYKTLKLLSQQSVEFNEDELSELRGESYNFAEKMLLSEKLDRSYSDTEEYLRDRSRFHS
PDRSTYSEGRSSAPRTEYVFRSSRNAYDQSGHLANVDDNFDKLTLLQYSSEPGSPKHSVW
MRVSDDTQNNEVGQIMYEDRVDRTVKEAEEKLSEVSQFFRDKTEQLNDELSSPEKKSRRP
DFRESRSGPSSTQSSPERSPYRSGCIGEEWNRERLRDKFASSDRKCASLPSSPERRALLQ
FSDTDSRKQRDDTSQRSVGDSLKSSQMTSSKVSAVRLKFEQEAQRQQRSPQSGQNSNLPV
RKLQETKLPVYQIFGGSSVSKTPDTPVTQRKCIGNDSNAFSPKHATSEKEKAQEESSLFK
TRDGQRYGHYNPQSPKSSHNSANDFNKNDSQRQEAAKKVIYTEYVVRDSPNCNSSLKKNS
ESQIPVKKSSNYPEKQKFSPYLTLDESHEKSGSRTAISARNQSKGSSESNKSTQGLSSGK
STPDSSQSNVLCNGVDDDQIEYLGQVTPVVITEGFKDIKPLPVYVSIQVGKQYEKEEASG
QLGTYKKIVSHESRTVHESRGAFYTVKQKQSPSPQGSPEDDTLEQVTFMDSSGRSPVTPE
TPSLEEMSLASRAPDSAIGFMTGMPSPIPEESEEEEGKTFIYKEPSKEKSKPPSPEIRSK
NQDGERRKLGEKRVAYIEFPPPPPLEAEQSGPKKKGSQASSEAETEMMEVNLQEEHDRHL
LSEPVIRVQPPSPIPPGADNSDSSDDESVFHPIPVKKYTFKIKEEGGEKRSKQKKSEKNG
NNDSGVNGVLKGDDADFEQNGNDQSITDCSLATTAEFSHDTDATEIDSLDGYDLQDEDDG
LSEDPKTSSLSNDGKMTDRSFSQSKLEVIEEEKCEDGGDNGNAKSSKSSKNSDGAEKDYT
LEGRHPDRHGFGENCFGYQLEEELNSTFKTVATKGLDFDPWSTKGVDNEGVFDPKAKEED
PKPFSLSVEDKSQATTPDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSGAIDMSKRD
FVEERLQFFQIGEHSSDPKTGEKGRGGKILGGLSSQSKTGERYTVDGKIQVVDTDLDSST
IPTASAEATAKCSPTQPGSDYAGTDVPACEAIAETASSCTITASKVDSKLRTPIKMGIAA
SITLKKDSGDVTDCKAEISGGQVVPEYISTEAQCTEKKSSNHAEPQQDKKEYPLENFNNN
NNLESSSVQANYIQCGSVVFNLQSSSEPILQKASRIETTCYRDLEEKVEVHHSRPVQEQK
NETVKESEVKQPKSRLPVKAPGWSFHTQGTAIGKQKPKQAITAQIRKRGEPAIAKVAPRS
RIPIKDIKKNSPAATTCSPLPVQGTSQLMKKLEKETRAIQLPTRLPFKSSNQVTSVTIEG
ACRQDRKENPSEICKRTIEYFKDISGETLKLVDRLSDEEKKTQTEQSEEDSTSRSTSLSD
ASQPSQPSQPSQPSRSSRSGRGSRAEAGAASVRAKVATTDRASGSERNRRSRRTGPQSPC
ERTDLRMAIVADHLGLSWTELAREMNFTVDEINHIRLENPNSLTAQSFMLLKKWVSREGK
NATSKSINKFTGHEVEKSEVTTILEGQSPGVEKADEDCRESFQKDQGGHEQEEKNVSSLS
GWHSDSSSVNVEPPTPGRSVSSDLLNRRESQENSSDSITSSSRGESGRSQQNGDNSKLS
Download sequence
Identical sequences H2LL95
ENSORLP00000006805 8090.ENSORLP00000006805 ENSORLP00000006805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]