SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006963 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006963
Domain Number 1 Region: 948-1007
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000196
Family BSTI 0.05
Further Details:      
 
Domain Number 2 Region: 1336-1394
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000507
Family ATI-like 0.027
Further Details:      
 
Domain Number 3 Region: 571-628
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000589
Family BSTI 0.058
Further Details:      
 
Domain Number 4 Region: 618-672
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000879
Family Fibronectin type I module 0.062
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006963
Domain Number - Region: 236-283
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family Fibronectin type I module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006963   Gene: ENSORLG00000005533   Transcript: ENSORLT00000006964
Sequence length 2005
Comment pep:known_by_projection chromosome:MEDAKA1:19:6123502:6133396:-1 gene:ENSORLG00000005533 transcript:ENSORLT00000006964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STLRLWVSYCFFSLCKDIFNVSEPLYPIAGTESSRVDDGSSPPITLQRTFLYFGQAYHRI
YVNHNGHLTFDTAYSATTPDRFPIHGSRDIIAPFWTDLDNRQMGKILYNQYTNGSVLQQA
TQDVNTYFPNLNFNAEWVFVATWYEVAYYSNSGTKTTAQAVLISGGQYSFVLMNYGIIAS
TSRSVQAGYDTIRSEHHYTIPGSFTSAATGSNSNFRLSSNVDVPGRWAFRTDHGARGCTF
NGEPVQLGDSFWSDSSCAQKCTCTSTGLQCSNQPCSFSQVCMPDTFQFSCQTVQRQTCTI
SGDPHYYTFDNKRFTFQGTCTYVLSEQCQKELPYFRVEGKNEHLGSTHVSWTGLVKVFVY
NETIELVKRTTGKAKVNGNFVATPFSLLQDRIQVYQSGMSMIVSTDFGLMVAYDRSYYLR
ISLPYTYQNATCGLCGNFNNNPGDDLQTPEGEIVSSEVVFANSWQVPGEDEPGCEAQCEG
LECAGCTAAQTALYSNNDHCGILQNSSGPFAACHQLLPPQNFVDSCVYDVCVGGGYQPFL
CQALGVYASQCQQNGIQPESWRRPGFCESEIPCPANSHFESQATGCPPTCVNPNSTQNCP
LPVQESCVCDTGYVLSAGECVPYAECGCSFEGFYYQSGQTVILDEDCGRRCSCTAGSMTC
SPHGCGPHESCSVDNGERGCRPNGYATCWIRGPGSYQTFDGLTYQYAGACKLTLAKVIGS
SDHPHFKVTSEKVPKGQQGFGQFITFEAEGKHISIELERNAKVKVDGQLIRLPFSSGSNQ
IHIFQSNTQSIILRTSFGLTVQTVWPHFVRVTAPVVYTSSLGGLCGNYNNEPNDDFQTPN
GTLVHSSQVFGDSWREGSLASHCVENTFHNSTTNYNSSDYCGILTSPHGPFTPCWDAVNP
SQQVDVCVDILRRSEDPESTLCLVLRDYVLMCQQQGVSLGEWRNTTGCAATCPSNSHSEV
CGTSCPSTCPSLSFPFSCDTPCQDGCQCNDGLVLNGNQCVPPTSCGCYHQGRYWESGQQF
WDGEECQSLCSCNGVTGVVSCVPHSCGSNEACRVVDGEFGCHPNPHGTCSSSGDPHYITF
DRKAYDFQGTCRYVLATVCNVTSGLTDFSVEAKNEQWNGLALSLAAEVFVQVWGYWIHIS
RNRHGVAEVNGITRNLPILLNESRVSIYTSGSRVFVSTDFGLTVTFDSYSTVMISVPPDY
RYRGKVCGLCGNFNGNKNDDFHGPDGAAVTTPDAFGAAWKVPGNYTCSDGCGSSCPQCTD
DQVARVQCEVIQAADGPFSFCHEEVDPAPFFNDCVFDVCVGGNAGNDLLCRAIEAYVSAC
QSANVRIYPWRQNTTCSIHCPANSHYELCGTDCGHTCASSTDATCEHACSEGCFCDEGFV
RSGTTCVPVERCGCQYDGFYYNVDESFWTEGCSQRCECHGPNDLRCLPASCTPAQQCSIK
DGQLGCYDAMSTCTVLGDPHYISFDGGVTNFQGTCSYIITESLNHDNNETQFQVVATNEH
RGNNFVSFVSTVDIFLSKQHESVHVWIGSNRRVKVNGIEASLPTPAGTLAQVSRQGSYIV
FDAIDFIVQFDGQRTLMVRMSQSRENRVTGMCGNFNGDPSDDKVFPNGTNTQNDKEFGNS
WKSPMSQPGCGSTDEESDGIGNCRFLEEYSELCSIITNTSGPFSACHLHSDPQPFFSSCV
YDLCLYTPANGMLCSAVSAYEKTCTVLGLDIPEWRPALHCDESDPCEQLDCTENEWCGEQ
EGVYGCFCDEHHHGPNNESFADSSITCVSSSGTLSLSRCQLFEAGFHLSDLHLRDDSCNG
TLQDGRLVFHFNNDDKLCGTVLMSNGTHFIYENSVQGDVDPHDRIISREKSIHLLFSCVY
PLAQALSMDVGINPLESIVNKRLPSGEGHYHLRMIPYEDPNFQSPLNRNRNLEMEINQRL
YIEVLTEGVDERQISTILDSCWATPFSDPSYPVRWDLISNECPNPDDGTVELVQNGISTV
ARFSFKMFTFTNYSSIYLHCQVHLC
Download sequence
Identical sequences H2LLP8
ENSORLP00000006963 8090.ENSORLP00000006963 ENSORLP00000006963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]