SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006990 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006990
Domain Number 1 Region: 250-300
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family Fibronectin type I module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006990   Gene: ENSORLG00000005555   Transcript: ENSORLT00000006991
Sequence length 314
Comment pep:novel chromosome:MEDAKA1:19:6237522:6240957:-1 gene:ENSORLG00000005555 transcript:ENSORLT00000006991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVLVLLLLMSGLCKYGICTLPNLCPLYPINGTASSQSDDGSSPQIVLQRPFVYFGQRYNS
IYVNHNGHLTFTVPYSSWTPQAFPMHGSLDIIAPFWTDLDNRGNGFVYYNQYTNGIVLQQ
ATQDINSYFPSINFNAEWVFVATWYEVAYFPMTGTRTTVQAVLISGGQHSFLLMNYGVIA
LTTRAEAAGITLIALTVKVEEAGYDTTHSVHHLTIPGSFSSSATGDNSTFSISSNVNVTG
RWAFNINSRTRGCQYNGEPVQLGDSFWSDSSCAQKCTCTSTGLQCSNQPCSFSQVCMPYS
FQFSCQTVQRRTCT
Download sequence
Identical sequences H2LLS5
ENSORLP00000006990 8090.ENSORLP00000006990 ENSORLP00000006990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]