SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006999 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006999
Domain Number 1 Region: 49-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 2-27
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000235
Family Somatomedin B domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006999   Gene: ENSORLG00000005563   Transcript: ENSORLT00000007000
Sequence length 437
Comment pep:known_by_projection chromosome:MEDAKA1:15:18075939:18080400:1 gene:ENSORLG00000005563 transcript:ENSORLT00000007000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSCSCSSSCQYYGNCCYDYYDYCQTAPAHTTASTPSPSGPCGGSLFGSGTFSSPNYPSY
YYDNSYCVWQLRASHDQRIYLALTFLQLENCCSCDHISVYDGPSIHSPQLGRVCNNNTSL
SAFFSTSNYMTVVFQTDGSVVARGFTAEFLSSLKPNSGRVDCSSDSMHIVLDRSYLNSLG
YDGHSLYLRDPYCRPQISYYNVVFSFPLNTCGNVRDVMNDRIVYTNNIYAYSSINGEITR
QSQFKMNVTCIMEQDSISQIMFVADTGLNTTITGSGRYNTSMDFYTSSSFYNKVTQVPYE
VSVNENLYVQVDLRRGDSSLVLFIDTCVTSPSPFDFYSRPYFLVKDGCPVDSTYYSISSG
SQPLARFSFKAFQFLRATDEVYIQCKVLICPASDYNSRCRRGCRRRNKRSLGSNHDSHTL
VVGPIKLKGQFAKMTSS
Download sequence
Identical sequences H2LLT4
ENSORLP00000006999 ENSORLP00000006999 8090.ENSORLP00000006999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]