SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007058 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007058
Domain Number 1 Region: 805-884
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-24
Family DEATH domain, DD 0.0000352
Further Details:      
 
Domain Number 2 Region: 129-221
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 220-271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000131
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 4 Region: 274-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000615
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 23-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000152
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007058   Gene: ENSORLG00000005617   Transcript: ENSORLT00000007059
Sequence length 893
Comment pep:known_by_projection chromosome:MEDAKA1:9:10619751:10713511:-1 gene:ENSORLG00000005617 transcript:ENSORLT00000007059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDFLSLSELPETFPSDPPEPLPHFLFEPEEGYIVKNKPVNLYCKATPATQIYFKCNSEW
VHQKDHTVEERVDENSGLVVREASIEITRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAH
VRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYIT
IDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSPCNSRCGRG
FQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLCTVDGVWTEWSKWSACGTECTQWRRRE
CNNPAPKNGGKDCEGLVLQSQNCTDGLCMQTAPSTDDVALYVGIVIAVIMCLVISVIVAL
FVYRKTHRDFDSDIIDTSALNGGFQSVNIKTARSADLLTAPPDLTNAAAMYRGPVYALHD
VSDKIPMTNSPLLDPLPNLKIKVYNSSGLVTPQDDLGGDFTSKLSPKITQSLLENSDTMN
LRNQSLARSRDPSCTAHGSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDS
LRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQEDWLIQLKNRLSMGEWEDV
VVVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSIGKAAAKRLKLAVFGPVSCTTLD
YHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSK
LIAKYQEIPFHQVWSGSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLE
EELQCIDTSLMDPASNITTLTGPNAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLD
RYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHDSSLASMTCE
Download sequence
Identical sequences H2LLY9
ENSORLP00000007058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]