SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007093 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007093
Domain Number 1 Region: 500-689
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-54
Family DBL homology domain (DH-domain) 0.0000000186
Further Details:      
 
Domain Number 2 Region: 694-823
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-37
Family Pleckstrin-homology domain (PH domain) 0.000000832
Further Details:      
 
Domain Number 3 Region: 182-319
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000082
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 4 Region: 278-419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000138
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 5 Region: 18-91
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000262
Family CRAL/TRIO domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007093   Gene: ENSORLG00000005630   Transcript: ENSORLT00000007094
Sequence length 823
Comment pep:known_by_projection chromosome:MEDAKA1:2:29519102:29532069:1 gene:ENSORLG00000005630 transcript:ENSORLT00000007094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVAMFPGYGHRRFRAQTSGSFPGILHLVLVLRPTTFFQRTISDLQLRFIRDDFKMKVPVV
MLSSVTELHAYIDPGQLTTEVGGTQDYNHDSWISHRTAIEAFALMVKTIAQTLQAFGTEL
AETELPNDAEATTNLLQAHTCKKEQMKEDLQVALSQGRRLLDIINEPLLVDPEYNMTHDE
MENLATVQRLIGQLDETETAFEDFWERHRTKLEQCLQLRHFEHHFREIRAQLDVTSERLS
GFSEVSVSPAHAEHVLQELSNHEDKAFALLDVALSLAGEGDGLIENSHYAEDSIRPKCRE
LRDVCEEISSTLRHKKSLLLRALELHHALEKASGWCEEGIFLLASQPVDRCQSQDGAEAA
LQELERYLDTAALHTLTDRSAICCQYETVLNTQLRDQIERVFQKQISVQEMFEKRRVSLK
KLAAKQTRPVQPVAPRPEQSLHLNERLYFFKVINRGCNVFSERWQLRANVTHRRLLMMSS
SGGQEITPEQYKASAFLSEEEESLAVLRRHVMNELLETERAYVEELLCVLEGYAAEMDNP
AMAHLIPSTLHSKKDILFGNMSEIYHFHKRTFLKELEAYTDCPELVGRCFLERMKDLQIY
EAYCQNKPRSESLWRQCSDCAFFQECQKKLEHKLGLDSYLLKPVQRITKYQLLLKELLKY
SKGCDGSNDLQEALSSILGILKAVNDSMHLIAITGYEGNLSELGRLLMQGSFSVWTEHKK
GHAKVKDLARFKPMQRHLFLHQKALLFCKKREENGEGYEKAPSYSFKHSLSMSAVGITEN
AKGDNKKFEIWCNSREEVFIVQAPTPEIKTSWVNEIRKVLTQQ
Download sequence
Identical sequences H2LM23
ENSORLP00000007093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]