SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007160 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007160
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000664
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 2 Region: 209-301
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000651
Family I set domains 0.0085
Further Details:      
 
Domain Number 3 Region: 136-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000285
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007160   Gene: ENSORLG00000005697   Transcript: ENSORLT00000007161
Sequence length 302
Comment pep:known_by_projection chromosome:MEDAKA1:14:13264090:13267273:1 gene:ENSORLG00000005697 transcript:ENSORLT00000007161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVGSKVDLRCRFINSSPPVKISQKVTWQKLVNGTKQSVAIANPSLGVSVAPPYRDRVTFR
NAAVRRRTPSLEDTTIIFSSLRLSDEATYICEYTTFPAGNRENSVNLTVHVRPTTQMSLS
SPTLVARSSNLKTPVATCISANGKPPGTIRWETRVPGEVTTREYRNSDGTFTVQSDYILV
PSKETHRETLTCVTTYNEEVYTDSVTLDIQYEPDVTVEGFDGNWYLNRENVRLTCQADAN
PAVSLYQWRLVNGSIPSSVEVRDSILLFKGPITYDLQGTYACDATNSIGTTSASVEVNII
GT
Download sequence
Identical sequences H2LM90
ENSORLP00000007160 ENSORLP00000007160 8090.ENSORLP00000007160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]