SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007233 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007233
Domain Number 1 Region: 45-194
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.26e-24
Family Growth factor receptor domain 0.00066
Further Details:      
 
Domain Number 2 Region: 196-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007233   Gene: ENSORLG00000005755   Transcript: ENSORLT00000007234
Sequence length 321
Comment pep:known_by_projection chromosome:MEDAKA1:16:10874736:10885690:-1 gene:ENSORLG00000005755 transcript:ENSORLT00000007234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQVISFVLIILHCMDFTGCQPHSSSRHPQHKSISGVSSGCQQGGCLTCSDYNGCLSCK
PRFFMHLKRIGMKQIGVCMTSCPPGFYGTRSPERNTCTKCRSECDSCFDKNFCTRCRAGF
YLHLGKCQESCPDSMVHNDTQRECVLSCPAECELCVNSETCMRCRQGFYQLNGKCYHICP
EDYEPNDRLMECTPQVHCQVGEWSEWSPCIRSSKTCNRRGQEARMRQILQTPSQFGRPCP
LTTEVKDCLVKRKRCSGRRNPERKERRNRKNRKDKESDEGRREKKRGRERDRGTGERENS
ENRNKTEHRHRRGHNTETASP
Download sequence
Identical sequences H2LMG2
ENSORLP00000007233 ENSORLP00000007233 8090.ENSORLP00000007233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]