SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007279 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007279
Domain Number 1 Region: 193-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-53
Family DBL homology domain (DH-domain) 0.000000376
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-38
Family Calponin-homology domain, CH-domain 0.0043
Further Details:      
 
Domain Number 3 Region: 381-542
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-34
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 636-766
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-28
Family SH2 domain 0.0006
Further Details:      
 
Domain Number 5 Region: 786-845
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 6 Region: 593-665
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000104
Family SH3-domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007279   Gene: ENSORLG00000005788   Transcript: ENSORLT00000007280
Sequence length 851
Comment pep:known_by_projection chromosome:MEDAKA1:20:9449390:9547123:-1 gene:ENSORLG00000005788 transcript:ENSORLT00000007280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCALWLINCKVLPASHRVTWESAQVFDLAQTLRDGVLLCHLLNNLRPQSINLKVI
NLRPQMSQFLCLKNIRTFLAACNEVFGMKKSDLFDAFDLFDVRNFGKVMDTLSRLSHTAI
AQQTGVRPFPTEDSVDDEDIYNHLEDLMDENGVEDEEDLYDCVYDDEEGGEIYEDLMKTE
AIAPPPFQKQAETDIRSCCLTEIKQTEEKYTETLESIEKHFMTPLTMFLSLVEIEKVFVN
IPELVRVHKCLLLELQDSVLHRSAQNLYQIFIAFKERLLIYGKYCSHVETAIATLDDICK
NREDVRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDTADKSNLRKA
LDAMKDLAQYVNEVKRDNETLREIDQYQKSIENLNQSLRNYGRPKGDGEVRVTSVDRRAK
QDRHIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKENRKWSYGFYLTHNQGQ
SGFEFFFKTKELKKKWLEQFGMAISNIRPENAADNFHEFRMHTFDRITSCNSCHMLLRGI
FNQGYLCSKCGLGAHKECLGRFGSCGKTGRQNFFSGIQEDKDFNKGHDWKHKSTGLPKML
AVTNYSGDPSPASGPALYIQTGDIIELICADLQSRWWQGRILETKEVGFFPSEAVRPCPC
VPKPVDFSSQPWFAGPMERLQAEAELINRVNSTYLVRHRSKEYTEYAISIKYNNDVKHIK
ILTKDGCYYIAENKKFRSILELIEYYKHHSLREGFKSLDTTLQFPYRQAENAAVHRLNRS
GGNMLTPKVIGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVNGRVGWFPS
TYVEEDYRGHA
Download sequence
Identical sequences H2LMK7
ENSORLP00000007279 8090.ENSORLP00000007279 ENSORLP00000007279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]