SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007326 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007326
Domain Number 1 Region: 366-420
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000654
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 2 Region: 246-299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000798
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 301-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000288
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 424-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000602
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 70-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000929
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 124-170
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 7 Region: 176-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007326
Domain Number - Region: 493-525
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00392
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007326   Gene: ENSORLG00000005823   Transcript: ENSORLT00000007327
Sequence length 573
Comment pep:known_by_projection chromosome:MEDAKA1:17:8022096:8035864:1 gene:ENSORLG00000005823 transcript:ENSORLT00000007327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVKVLLPVVLLLVSVEHSECVRCFAAFNTTTGECSDELGEVDMDDCCHNPQYGYLTEE
GECQFCGLNVWSPWSSWTLCNNLCGEGVRQRRRTCFGLKESGCTNMNDVLHIEPCNGTCC
DVKAWDSWLPWSPCSVTCGGVGVRKRQRTCGSPPECVEVCSGPSQETESCASNNACPVHG
GWSSWSAWGQCSGTCIDDQRSDAVIPSRVRQRTCSNPAPSKDTIPKGDDCPGDAHQSQYC
SELPNCPVNGNWGEWAQPGPCSVTCGEGLQLSVRKCDNPSPKYGGEYCKGTSSRTSVCQS
PCPVHGIWSGWSNWGDCSSSCHFESKPATKTRQRSCSNPSPSSNPPGQNCPDQNSQTERC
NDLPFCPVDGSWGSWSSFSPCPVTCGVGLQESIRRCDNPAPKYGGRACSGERRITKTCFT
KVHCPVHGEWTEWSEWSKCKYPFGDKDINCKRIGGKQTRNRECVRAHNGSYCSGTKLLES
QVCYDVDKCRNLKGTWDGWEPWRYCVPQCGENSKRLRFRKCKPDYSSYSPTIGRQGDEAH
FSGTPKPDCGPTPDGGPKYEQQKCHNLPPCPEP
Download sequence
Identical sequences H2LMQ3
XP_011484484.1.28442 ENSORLP00000007326 ENSORLP00000007326 8090.ENSORLP00000007326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]