SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007339 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007339
Domain Number 1 Region: 124-318
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-44
Family DBL homology domain (DH-domain) 0.0000000744
Further Details:      
 
Domain Number 2 Region: 310-435
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-30
Family Pleckstrin-homology domain (PH domain) 0.0000588
Further Details:      
 
Domain Number 3 Region: 41-112
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-24
Family SH3-domain 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007339   Gene: ENSORLG00000005832   Transcript: ENSORLT00000007340
Sequence length 671
Comment pep:known_by_projection chromosome:MEDAKA1:2:29904927:29930967:-1 gene:ENSORLG00000005832 transcript:ENSORLT00000007340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLQFFPEPRSDSDFQKNIAEFLKGLAAFGVEDMSEGSGCGQPLVKARFPFQQTNEDELSF
SKGDIIVVRRQEEGGWWEGSLNGKTGWFPSNYVRELKGSDKTADKPKSGTLKSPPKGFDT
SIISKTYYNVVLQNILEAETEYSRELQSLLGSYLRSLQPTDRLSSGDISHIQANLEEIST
FQQMLVQSLDDQTKLPENQQRIGGFFLSLMPQMKTIYVSYCSNHPSAVGVLTRHSEELGG
FMESKGASSPGILALTTSLSKPFTRLDRYPALLKELERHMEDQHPDRADLHAVMAAFKHL
AAECQEVRKRKDLELQILTEPIRNWEGEDIKSLGAVLHMSQVTVHSQNCQEVNERYLVLF
PHTLLVLSASLRMSGFIYQGRMPLSGMLISRIEDGENWRNAFEISAGGQCERMQVACNSQ
RDLQDWLDLLTKHTHTPAHTHRPPCHTLPSHTVTSSRHSEARAGSSAYHTLPHLSSCETS
HSAPSWGPLEPPSTPKPWSLSCLRPAPPLRPSAALCFKEDMSKSPKNMKKLLPKRKPERK
PSEEDVTVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSRCSRKDVQMLFPEEEKIIVE
ETRSNGQTVVEERSLVDTVYSLKDEVQELKQDNKRMKRTLEEEQRARKELERIVRRVLKN
MNDPTWDETNL
Download sequence
Identical sequences H2LMR6
ENSORLP00000007339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]