SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007492 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007492
Domain Number 1 Region: 926-1118
Classification Level Classification E-value
Superfamily Bet v1-like 2.59e-53
Family STAR domain 0.000000448
Further Details:      
 
Domain Number 2 Region: 678-846
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00038
Further Details:      
 
Domain Number 3 Region: 10-79
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.38e-33
Family Variant SAM domain 0.0000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007492   Gene: ENSORLG00000005951   Transcript: ENSORLT00000007493
Sequence length 1119
Comment pep:known_by_projection chromosome:MEDAKA1:1:17701084:17715692:-1 gene:ENSORLG00000005951 transcript:ENSORLT00000007493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWKQERGERLMVNEIEAKEACTWLRAAGFPQYAQLYEDAQFPIDISSVTRDHDFLDRDAI
EALCRRLNTLNKCALMRLDLSPQRKRSEDSDEDEPCAISGRWTFQRDSKRWSRMEDLEVF
SELQADPVQPSFPKDQVSQKGKLGLREGNSSESVLTDLSEQPEVGSIHSSGSGGRGEEKG
HAAALLNETIPTGALRANSVASMCSSSGTGGSGGANEDSLSDGLPPSPLDSFRQFTFDVD
TGMVGGHLDRGEGSGKSARSRAKGFLKRMESLRLRSGTSSKRKKKTSPTNGRIEISGPVI
KEGFDDDKLRKLNCVDISSINLNNQCNPTQTMTLNRNRSLSYSTQTSNGSTGSTGSSQSE
ASSGSAVSTPSPVTRARSHSTAAGFSKRGGMYLEGFDPFSFLQQVPDKIRQEEDEEDDDE
EEGGMIFFYLPEDHKPGTFPKDLHDGNSRNNNGNDNGNSVVLRGRQSRRQRCSSSGSVDC
RLSFYDNVPYTEREEEEGDEHKLEEVLQHVSGLQRFVNAWSEAAACEEEEEDDDEVEEGD
SDSALDSASPCPSSPLQNRLEETENGSDQDSTGNPLGEAEEGMRERRDSGVGASLTRTSR
PQKLRWPSFQNSHRPSLASAQLQISCQSVLQMNLLQKLSLLQLTALLEKHTPTNKHGFSW
AVPKFMKRIKVRDHKDRNVFGVSLQVIVQRTGQPLPQGIQQAMRYLRNNCLDQVGLFRKS
GVKSRIQALRQMNEASGADGCGVNYEGQSAYDVADMLKQYFRDLPEPLFTSKLSETFLQI
YQYMPKELRLQATRAAVLLLPDENREALRTLMCLLSDVTASVAENQMTPTNLAVCLAPSL
FHLNTLRRKESSSPRVMNRKQTLGKPDQRDLNENLAATHGLTHMIQECRKLFRIPEEMNR
CRNSYVEQALLPKRLEELGSEAKRGSILQESLDTLLKEAKDKFRGYDSCSTPEHVELAYR
KVNDGFPLRQWKVTVEIHASPEEVLTRVLREQGQWDEDLLESRVVETLDQRTEVYQYVRN
TMAPHPTRDHVVLRTWVTDLPKGACALVSSSVDHDGAPMVGVRANVLTSRYFIEPCGANK
SRLTHISRVDCRGRFPEWYNKLYGHLCAAEVARIRESFS
Download sequence
Identical sequences H2LN67
8090.ENSORLP00000007492 ENSORLP00000007492 ENSORLP00000007492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]