SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007554 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007554
Domain Number 1 Region: 514-571
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000458
Family BSTI 0.084
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007554
Domain Number - Region: 666-750
Classification Level Classification E-value
Superfamily FnI-like domain 0.00068
Family VWC domain 0.035
Further Details:      
 
Domain Number - Region: 829-913
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00421
Family Transforming growth factor (TGF)-beta 0.084
Further Details:      
 
Domain Number - Region: 759-821
Classification Level Classification E-value
Superfamily FnI-like domain 0.0199
Family VWC domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007554   Gene: ENSORLG00000006006   Transcript: ENSORLT00000007555
Sequence length 929
Comment pep:known_by_projection chromosome:MEDAKA1:6:10600427:10606633:1 gene:ENSORLG00000006006 transcript:ENSORLT00000007555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPPTQSTTTMETSTTTVSTTTPTRQTTSTMEQTTTTQTIKPPEFTTSTPESTTTTSTTVA
TTTPEMTTTTEATTTSTSTACAPTCDWSEWYNKPNKLLKNQPLRPGKCFDYKIRVCCPVS
TCQPTASTLTTIFTTSTPESTTTTTTTVPKQTTTTPKTTAPSTLEPTPTSYTPSCPEWDV
VQNETFVLCNCTMARCIENGTIEIIPYECPPLQNITCASGKKPVLVYDEFYCCQHYVCDC
VCEGWGDPHYITFDGLYYSYQGNCTYILMEEITQTHNLKIYVDNVYCDPTEDVSCPRSII
ISFNSQVITLVNHNLIGAPRLEAFENGESLRLPYSQHGMKVLSSSLNLVFEIPRLKVVIT
FGMTGFSITLPYRSFGRNTQGHCGTCTNNQADDCMLPGGQLVENCAIMADYWLAQDIYQP
DCEVPSVLPTSPPEPPVEPTPCNPDSICDLIKSSVFAECHSLVSPDNFYRGCVFDSCHVS
NPAVECTSLQTYAAACAQAGVCLHWRNHTKLCDYSCPSDKIYKPCGPAEQPTCEDNPNEP
SFNYTIEGCFCPDGMKLFNKDSGICVEKCGCLDPEGIPREFNERFEYKCQDCICDESTKT
IVCKPKTCPPPHNADCTTPGFVVVNQTNPEDPCCYDYVCECQISTCPANTINCQVGYKPV
MSVPEGKCCPEYLCEPKRVCVHKEIEYQPGASVPAHVCQNCICSNEVDPKTGLFKVVCEF
MLCDQNCGAGFEYVETDSDVCCGECVQKDCVIKINSTQHILTEGQTWSPPGNKCEQYTCV
KNDDILTTVTSHIICPMFQESNCEPDSIQTAANGCCKICKQKGVEKDKACKVVSMTTRVT
HNGCQAEEEVDMPYCEGSCNTFTKYSEAAAAMQHSCSCCKETRFSNRTIDLLCLTGEKIP
FTYMHVEECGCGKTACTKPAGLPSRRKRS
Download sequence
Identical sequences H2LNC7
ENSORLP00000007554 8090.ENSORLP00000007554 ENSORLP00000007554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]