SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007597 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007597
Domain Number 1 Region: 242-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-78
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 53-150
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-17
Family Kringle modules 0.0016
Further Details:      
 
Domain Number 3 Region: 193-246
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000167
Family Kringle modules 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007597   Gene: ENSORLG00000006046   Transcript: ENSORLT00000007598
Sequence length 522
Comment pep:known_by_projection chromosome:MEDAKA1:18:14058419:14071825:1 gene:ENSORLG00000006046 transcript:ENSORLT00000007598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GESWGRIHLRNVEQCTCVEGEIQCQRVPYTTCHSNPCQNDGTCRLITSTGKEVCSCRSSY
AGPHCDLQPNTECYKSRGTAYRGVVDTTVSGARCLPWNSDLLYDELHVGTVVAPNLRGLG
EHGFCRCVRSKGGNWSYVNKETQVIIDLCSNCTILTSVDSLGETLDGHMHASTDAGNTLY
YYELRMYHKRSRFHSWKMHKLYIATAVCRNPDGDQKPWCYTVNDSAISWEYCDVPTCVKP
SLKVTVSTTVKKPTSTTKTKSPTCGMKHKKRLTLPRGRILGGSSALPGSHPWMAAIYIGK
SDFCGGSLISSCWIVSAAHCFLSNPLKSQLRVVLGQHFFNNTKFLSNHSRIFEVEDLILP
KHFSVFNPTLHDIVLIKLKKQDGRCVRKSPFIRPICLPEKNMQFPDGYCCTISGWGYTQE
KARDYSPLQEANVRLIPHETCKKPEVYGNHVTSDMICAGLDCVDACQGDSGGPLACAKGD
VSFLYGIISWGEGCGRVGKPGVYTKVVNYIDWIQSVIKRKAK
Download sequence
Identical sequences H2LNH0
ENSORLP00000007597 8090.ENSORLP00000007597 ENSORLP00000007597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]