SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007607 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007607
Domain Number 1 Region: 257-315
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000576
Family BSTI 0.028
Further Details:      
 
Domain Number 2 Region: 619-679
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000017
Family BSTI 0.045
Further Details:      
 
Domain Number 3 Region: 718-780
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000051
Family ATI-like 0.0084
Further Details:      
 
Domain Number 4 Region: 1655-1719
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000222
Family ATI-like 0.052
Further Details:      
 
Domain Number 5 Region: 1089-1144
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000811
Family BSTI 0.079
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007607
Domain Number - Region: 315-380
Classification Level Classification E-value
Superfamily FnI-like domain 0.000199
Family VWC domain 0.083
Further Details:      
 
Domain Number - Region: 1315-1383
Classification Level Classification E-value
Superfamily FnI-like domain 0.00303
Family VWC domain 0.026
Further Details:      
 
Domain Number - Region: 1812-1897
Classification Level Classification E-value
Superfamily FnI-like domain 0.0045
Family VWC domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007607   Gene: ENSORLG00000006050   Transcript: ENSORLT00000007608
Sequence length 2069
Comment pep:known_by_projection chromosome:MEDAKA1:6:10650625:10677221:1 gene:ENSORLG00000006050 transcript:ENSORLT00000007608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSTWGNYHFKTFGGKFFQFPFTCNYIFATHCKTSYEVFNIQLQREEVEGVVTIKRVIMKL
DGLVVELASSSITVDGNGVTMPYKKAGLSIGSFSSYVKIETSLGLVAMWNQEDSFWVELD
SRFQNQTCGLCGDLGDINSADDSVQSENFIDAEIYAESFQVKDPSGNCESVPSQSQICTN
QDPQISLCKDLIAGPAFSSCPDLLNTDPFIKACMKDLCSCKSSNTECLCSTMSEYSRQCA
HAGGAPQSWENQHLCTKSCPYNMVYQECGSPCTDTCSNQQRSQMCDEHCVDGCFCPAGTV
LDDISQTGCVPLDQCSCSHNGELFQQGESYHQTCKQCTCFKGVWNCEDLNCPGVCSILGG
SHISTFDDKAYTFHGDCSYVFSKETNGYFTILGDLVKCKNSDKSTCLSSVTLKHLNHTID
VKDNKDVFYNSFSPKLPLFMDDIAIFKPSSFFIIIHTSFGLDIEIQLVPVMQIYIKADVS
FKEKLKGLCGDFNDVEADDFRTSNGIVEGTAVTFANTWKVKATCPDVKAVLEDPCALSIL
KEKFAKNWCLLLSDPTGMFSACHSKINPEDYENACVYDTCACENSEDCMCAAISSYVHAC
AAEGISFDGWRSNMCSKYTQDCPSTFEYKYNMTGCGHTCRSLSQPDLTCPMQFTLVDGCG
CAEGTYLDESGVCVSASQCSCYMGDTPVQPGQVVMVSGQSCTCHSGKLSCIGQHTIETCS
DPMVFFNCSSASTGEKGAECQNTCLTLDTECMSTQCTSGCVCPDGLLSDGKGGCVKEDDC
PCSHNGELYNPGQTITVNCNTCTCKSRNWECTEKDCTSTCTIYGEGHYITFDQKRFTFNG
DCRYIFAQDYCGNDMDGTFRVLTEMVCAATESVCSTAVKLFLGNTEIILSDESVKVIKQK
EGSDVLFKVHTMGLYLVIEAKNGLVLIWDKKTTLMVRLSSTFKRKVCGLCGNFDGNIKND
FTTQRKEVVTDATEFGNSWRVSTECPNANTTENACSLYSHKKAWALKHCDIIKSDVFALC
HSKVDPQSYYDACVRDTCACNTGGDCECFCSTVAAYAAACNESGVCVKWRTPTICPVFCD
FYNPDGECEWHYAPCGRPCMKTCRNPSGTCYSELPPLEGCYPSCPSERSYLEEVSMKCVS
KEECGCYCSVTQTDCTYDVHACKCFYNNIYFKYGDEIYNTHDGNGTCITAVCGKNGNIIR
DYTPCQTLPTPSTTVFVFTRSATSTAPIISTRTTPCSCKYLNQTYYPDSHIYNKTDKGGW
CFIAHCSLTCKIEYIFQPCNVTTPPRPPTSPSFPISTASSSTPVHGRTTTSRVSLDCLFL
KPPRKNGESWKSDKCTTEKCENGKVILNHVPCKQVTIPVCENNQPPVRVYDEGGCCFHYE
CRCVCSGWGDPHYQTFDGEYYSFQKNCTYVLIKEIIPRHNFKIHIDNENCNPSGTVTCAK
ALNIFYKNDNITLTQKRGLKTVNMVFINGKQVTPAYSTKDLIITSTAIELLLKIPEIEAV
VTFKGLLFSVELPFSLFYGNTEGQCGGTCDNNRKNDCRLPDGSIHPLCSEMAFEWRVPDS
SKPYCNVKPPVVNPPPGPTPSSCKPEICDILMSKVFEECHKKIPPKAFYEACKFDVCHMS
NISAGCSSLEAYALMCAEISVCVSWRKATNGKCEYKCPQNKVYKPCGPTVVPTCNARYSN
SSNPIEKNGCTQFMEGCFCPDGMTLFSPTSDICVSSLGCTGPDGQPKQLGEKWQVGCKQC
VCDSNTQSVECRPLACPNQEPIKCTEDGEVLVNRTVDCCERLTCECDKNSCSPQSQECKL
GFELKVHVSNESCCPVFSCVSSKVPKGVCVYNDTEYKPDKTFSKSTCEICHCTDIQDPST
QLNTVDCHQKECSDSCDKGFVHMDQPGQCCGSCIPIGCVFYPPEGSSPVVLEPSESWSPP
NDNCIKYDCQKVNGDFIVSRNQTTCPEYDPDNCIPGTEKTDANGCCKTCKGTPRYSCQLN
RTTTFLVKGNCKSIEPVELTSCEGSCGASWSKYSVEDDMMMHSCSCCKELATSNKTVEMI
CADDNKQSHTYILVEECGCEDGECEEEDD
Download sequence
Identical sequences H2LNI0
ENSORLP00000007607 8090.ENSORLP00000007607 ENSORLP00000007607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]